CB304466

Overview
NameCB304466
Unique NameCB304466
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length683
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2177 contig Csv1_Contig2177:103..785. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304466 vs. ExPASy Swiss-Prot
Match: CML45_ARATH (Probable calcium-binding protein CML45 OS=Arabidopsis thaliana GN=CML45 PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.926e-37
Identity = 89/180 (49.44%), Postives = 114/180 (63.33%), Query Frame = -1
Query:   96 FAYIQGFLFHKFLTMISCVNTFFLSHRSFVQSQFESCESRNWDEKSQDFELFSKQASCNEKKHDDESLSRDQVETVMTNLTLFCSPEGEELPQKLGSRELSRLFEEKEPSLEEVKDAFDVFDENKDGFIDALELQRVLCILGMKEGFQLENCKKMIKTFDENGDGRIDFKEFVKFMESSF 635
            F  I  FL   F   +S    FF      VQ Q   C S   ++KS+D E  +       +  DD+ L R+ V  VM +L L    E E L ++  S+E+S LFEEKEPSLEEVK AFDVFDEN+DGFID ++LQRVL ILG+K+G  LENC++MI++FD + DGRIDF  FVKFME++F
Sbjct:   30 FGLINFFLIG-FFRWVSFAQLFFSRFWPLVQHQ--QCVS---EKKSKDLEFQTSIKHEEYRDDDDDGLCREDVGMVMKSLGLSTDQENEGLQKQYSSKEVSNLFEEKEPSLEEVKQAFDVFDENRDGFIDPIDLQRVLTILGLKQGSNLENCRRMIRSFDGSKDGRIDFYGFVKFMENNF 203          
BLAST of CB304466 vs. ExPASy Swiss-Prot
Match: CML30_ARATH (Probable calcium-binding protein CML30 OS=Arabidopsis thaliana GN=CML30 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.963e-33
Identity = 86/187 (45.99%), Postives = 113/187 (60.43%), Query Frame = -1
Query:   96 FAYIQGFLFHKFLTMISCVNTFFLSHRSFVQSQFESCESRNWDEKSQDFELFSKQASCNEKKHDDES-------LSRDQVETVMTNLTLFCSPEGEELPQKLGSRELSRLFEEKEPSLEEVKDAFDVFDENKDGFIDALELQRVLCILGMKEGFQLENCKKMIKTFDENGDGRIDFKEFVKFMESSF 635
            FA    FL   F   +S    F       +Q      + +N   K Q  E  +KQ   ++   DD+        +SR++ E VM +L LF + +  +L ++  ++E+S LFEEKE SLEEVK AFDVFDENKDGFIDA+ELQRVL ILG K+G  L+NC  MI++ D N DG+IDF EFVKFME+SF
Sbjct:   13 FALFNFFLI-SFCRWVSSTRIFLSRFVPLLQHHQRVFDKKN--NKDQQ-ETLTKQEDDDDDDDDDDDDDDDDIDISREEAEMVMRSLGLFYNDD--QLQEQYSAKEVSSLFEEKEASLEEVKQAFDVFDENKDGFIDAIELQRVLTILGFKQGSYLDNCLVMIRSLDGNKDGKIDFNEFVKFMETSF 193          
BLAST of CB304466 vs. ExPASy Swiss-Prot
Match: CML47_ARATH (Probable calcium-binding protein CML47 OS=Arabidopsis thaliana GN=CML47 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.413e-15
Identity = 41/69 (59.42%), Postives = 53/69 (76.81%), Query Frame = -1
Query:   96 EEVKDAFDVFDENKDGFIDALELQRVLCILGMKEGFQLENCKKMIKTFDENGDGRIDFKEFVKFMESSF 302
            E VK+AF +FDEN+DGFID  EL+ VL +LG  E  ++E C+KM+K +DEN DG+IDF EFVK +E SF
Sbjct:  115 EIVKEAFRLFDENQDGFIDENELKHVLSLLGYDECTKME-CRKMVKVYDENRDGKIDFYEFVKLIEKSF 182          
BLAST of CB304466 vs. ExPASy Swiss-Prot
Match: CML7_ARATH (Calmodulin-like protein 7 OS=Arabidopsis thaliana GN=CML7 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.148e-15
Identity = 37/75 (49.33%), Postives = 57/75 (76.00%), Query Frame = -1
Query:  105 LFEEKEPSLEEVKDAFDVFDENKDGFIDALELQRVLCILGMKEGFQLENCKKMIKTFDENGDGRIDFKEFVKFME 329
            + +E++   E++K+AF+VFD+N DGFI   EL+ VL  LG+K+G  L++CKKMIK  D +GDGR+++KEF + M+
Sbjct:   69 IMDEEDEEEEDMKEAFNVFDQNGDGFITVDELKAVLSSLGLKQGKTLDDCKKMIKKVDVDGDGRVNYKEFRQMMK 143          
BLAST of CB304466 vs. ExPASy Swiss-Prot
Match: CML4_ARATH (Calmodulin-like protein 4 OS=Arabidopsis thaliana GN=CML4 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.159e-15
Identity = 48/131 (36.64%), Postives = 81/131 (61.83%), Query Frame = -1
Query:  102 KHDDESLSRDQVETVMTNLTLFCSPEGE--ELPQKLGSR--------ELSRLF----EEKEPSLEEVKDAFDVFDENKDGFIDALELQRVLCILGMKEGFQLENCKKMIKTFDENGDGRIDFKEFVKFMES 452
            K+ D  ++++++   + NL +F  P+ +  ++ QK+ +         E   L+    EEKE    +++DAF+VFD++ DGFI   EL  V+  LG+K+G  LE CK+MI   DE+GDGR+++KEF++ M+S
Sbjct:   61 KNGDGRITKEELNDSLENLGIFM-PDKDLIQMIQKMDANGDGCVDINEFESLYGSIVEEKEEG--DMRDAFNVFDQDGDGFITVEELNSVMTSLGLKQGKTLECCKEMIMQVDEDGDGRVNYKEFLQMMKS 188          
BLAST of CB304466 vs. ExPASy Swiss-Prot
Match: CML3_ARATH (Calmodulin-like protein 3 OS=Arabidopsis thaliana GN=CML3 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.481e-14
Identity = 36/75 (48.00%), Postives = 56/75 (74.67%), Query Frame = -1
Query:  105 LFEEKEPSLEEVKDAFDVFDENKDGFIDALELQRVLCILGMKEGFQLENCKKMIKTFDENGDGRIDFKEFVKFME 329
            + EE++   E++++AF+VFD+N+DGFI   EL+ VL  LG+K+G  LE+CK+MI   D +GDG ++FKEF + M+
Sbjct:   69 IMEERDEE-EDMREAFNVFDQNRDGFITVEELRSVLASLGLKQGRTLEDCKRMISKVDVDGDGMVNFKEFKQMMK 142          
BLAST of CB304466 vs. ExPASy Swiss-Prot
Match: CML5_ARATH (Calmodulin-like protein 5 OS=Arabidopsis thaliana GN=CML5 PE=2 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 4.546e-14
Identity = 35/70 (50.00%), Postives = 52/70 (74.29%), Query Frame = -1
Query:  105 EPSLEEVKDAFDVFDENKDGFIDALELQRVLCILGMKEGFQLENCKKMIKTFDENGDGRIDFKEFVKFME 314
            E   E++KDAF+VFD++ DGFI   EL+ V+  LG+K+G  L+ CKKMI   D +GDGR+++KEF++ M+
Sbjct:  138 ETEEEDMKDAFNVFDQDGDGFITVEELKSVMASLGLKQGKTLDGCKKMIMQVDADGDGRVNYKEFLQMMK 207          
BLAST of CB304466 vs. ExPASy Swiss-Prot
Match: CML2_ARATH (Calmodulin-like protein 2 OS=Arabidopsis thaliana GN=CML2 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.013e-13
Identity = 38/74 (51.35%), Postives = 53/74 (71.62%), Query Frame = -1
Query:  108 LFEEKEPSLEEVKDAFDVFDENKDGFIDALELQRVLCILGMKEGFQLENCKKMIKTFDENGDGRIDFKEFVKFM 329
            + EEKE   E++++AF VFD+N DGFI   EL+ VL  +G+K+G  LE+CKKMI   D +GDG ++FKEF + M
Sbjct:   69 MVEEKEEE-EDMREAFRVFDQNGDGFITDEELRSVLASMGLKQGRTLEDCKKMISKVDVDGDGMVNFKEFKQMM 141          
BLAST of CB304466 vs. ExPASy Swiss-Prot
Match: CML6_ARATH (Calmodulin-like protein 6 OS=Arabidopsis thaliana GN=CML6 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.947e-13
Identity = 36/73 (49.32%), Postives = 51/73 (69.86%), Query Frame = -1
Query:  105 EEKEPSLEEVKDAFDVFDENKDGFIDALELQRVLCILGMKEGFQLENCKKMIKTFDENGDGRIDFKEFVKFME 323
            +E E   E++K+AF+VFD N DGFI   EL+ VL  LG+K+G  LE C+KMI   D +GDGR+++ EF + M+
Sbjct:   73 DEDEVGEEDMKEAFNVFDRNGDGFITVDELKAVLSSLGLKQGKTLEECRKMIMQVDVDGDGRVNYMEFRQMMK 145          
BLAST of CB304466 vs. ExPASy Swiss-Prot
Match: CML28_ORYSJ (Probable calcium-binding protein CML28 OS=Oryza sativa subsp. japonica GN=CML28 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.910e-12
Identity = 33/65 (50.77%), Postives = 47/65 (72.31%), Query Frame = -1
Query:  108 EEVKDAFDVFDENKDGFIDALELQRVLCILGMKEGFQLENCKKMIKTFDENGDGRIDFKEFVKFM 302
            E +++AF+VFD+N DGFI   EL+ VL  LG+K G   ++C++MI   D +GDGR+DFKEF + M
Sbjct:   98 EGMREAFNVFDQNGDGFITVDELRSVLSSLGLKHGRTADDCRRMISMVDADGDGRVDFKEFKQMM 162          
The following BLAST results are available for this feature:
BLAST of CB304466 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
CML45_ARATH2.926e-3749.44Probable calcium-binding protein CML45 OS=Arabidop... [more]
CML30_ARATH1.963e-3345.99Probable calcium-binding protein CML30 OS=Arabidop... [more]
CML47_ARATH1.413e-1559.42Probable calcium-binding protein CML47 OS=Arabidop... [more]
CML7_ARATH3.148e-1549.33Calmodulin-like protein 7 OS=Arabidopsis thaliana ... [more]
CML4_ARATH9.159e-1536.64Calmodulin-like protein 4 OS=Arabidopsis thaliana ... [more]
CML3_ARATH3.481e-1448.00Calmodulin-like protein 3 OS=Arabidopsis thaliana ... [more]
CML5_ARATH4.546e-1450.00Calmodulin-like protein 5 OS=Arabidopsis thaliana ... [more]
CML2_ARATH1.013e-1351.35Calmodulin-like protein 2 OS=Arabidopsis thaliana ... [more]
CML6_ARATH2.947e-1349.32Calmodulin-like protein 6 OS=Arabidopsis thaliana ... [more]
CML28_ORYSJ1.910e-1250.77Probable calcium-binding protein CML28 OS=Oryza sa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIaR_C02 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIaR_C02 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304466 ID=CB304466|Name=CB304466|organism=Citrus sinensis|type=EST|length=683bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGTAAGGAATAAGGGAAACAC
CAAGCTCTGTGTTACTTATATTTCATAAATTAATTAGGATTCAACAAAGC
TACTCTCCATAAACTTTACAAATTCCTTAAAATCTATCCTTCCATCGCCG
TTTTCATCAAAAGTTTTGATCATCTTCTTGCAGTTCTCCAGCTGGAATCC
CTCTTTCATGCCCAAAATACAGAGCACTCTCTGCAACTCCAGGGCATCAA
TAAAGCCATCTTTGTTCTCATCAAACACATCAAAAGCATCCTTCACCTCC
TCCAAGCTTGGTTCTTTCTCCTCAAACAACCTGGAAAGCTCTCTGGAACC
GAGCTTCTGCGGAAGCTCCTCGCCTTCGGGGCTGCAAAAAAGTGTCAAGT
TTGTCATCACCGTCTCCACTTGATCTCTAGAGAGACTCTCATCGTCATGT
TTCTTCTCATTGCAGGAAGCTTGTTTGCTGAACAACTCAAAATCTTGGCT
CTTCTCATCCCAATTTCTTGACTCGCAAGACTCAAATTGGGATTGGACAA
AAGACCGATGGCTCAAGAAAAAAGTGTTAACGCAACTGATCATTGTTAGA
AACTTATGAAACAAAAAGCCTTGAATGTATGCAAAGAATTGATTAAAGGG
GTGTTGGGTCTTGGTTCCTGGTGATTTTTGCAT
back to top