CB304467

Overview
NameCB304467
Unique NameCB304467
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length332
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304467 vs. ExPASy Swiss-Prot
Match: DCS4_GOSAR ((+)-delta-cadinene synthase isozyme C2 OS=Gossypium arboreum GN=CAD1-C2 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.369e-12
Identity = 38/77 (49.35%), Postives = 48/77 (62.34%), Query Frame = -2
Query:   35 SSGETFRPTADFHPSLWRNHFLKGASDFKTVDHTATQERHEALKEEVRRMITDAEDKPVQKLRLIDEVQRLGVAYHF 265
            S+ +  RP ADF PS+W + FL      K +D   T++RH+ LKEEVR+MI        QKL  ID VQRLGV+YHF
Sbjct:   16 SNKDEIRPKADFQPSIWGDFFLNCPD--KNID-AGTEKRHQQLKEEVRKMIVAPMANSTQKLAFIDSVQRLGVSYHF 89          
BLAST of CB304467 vs. ExPASy Swiss-Prot
Match: DCS2_GOSAR ((+)-delta-cadinene synthase isozyme XC14 OS=Gossypium arboreum PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.050e-12
Identity = 38/77 (49.35%), Postives = 48/77 (62.34%), Query Frame = -2
Query:   35 SSGETFRPTADFHPSLWRNHFLKGASDFKTVDHTATQERHEALKEEVRRMITDAEDKPVQKLRLIDEVQRLGVAYHF 265
            S+ +  RP ADF PS+W + FL      K +D   T++RH+ LKEEVR+MI        QKL  ID VQRLGV+YHF
Sbjct:   16 SNKDEMRPKADFQPSIWGDLFLNCPD--KNID-AETEKRHQQLKEEVRKMIVAPMANSTQKLAFIDSVQRLGVSYHF 89          
BLAST of CB304467 vs. ExPASy Swiss-Prot
Match: DCS1_GOSAR ((+)-delta-cadinene synthase isozyme XC1 OS=Gossypium arboreum PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.050e-12
Identity = 38/77 (49.35%), Postives = 48/77 (62.34%), Query Frame = -2
Query:   35 SSGETFRPTADFHPSLWRNHFLKGASDFKTVDHTATQERHEALKEEVRRMITDAEDKPVQKLRLIDEVQRLGVAYHF 265
            S+ +  RP ADF PS+W + FL      K +D   T++RH+ LKEEVR+MI        QKL  ID VQRLGV+YHF
Sbjct:   16 SNKDEMRPKADFQPSIWGDLFLNCPD--KNID-AETEKRHQQLKEEVRKMIVAPMANSTQKLAFIDSVQRLGVSYHF 89          
BLAST of CB304467 vs. ExPASy Swiss-Prot
Match: DCS1_GOSHI ((+)-delta-cadinene synthase OS=Gossypium hirsutum GN=CDN1 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.373e-11
Identity = 37/77 (48.05%), Postives = 46/77 (59.74%), Query Frame = -2
Query:   35 SSGETFRPTADFHPSLWRNHFLKGASDFKTVDHTATQERHEALKEEVRRMITDAEDKPVQKLRLIDEVQRLGVAYHF 265
            S+ +  RP ADF PS+W + FL      K +D   TQ+RH+ LKEEVR+MI         KL  ID VQ LGV+YHF
Sbjct:   16 SNKDEMRPKADFQPSIWGDFFLNCPD--KNID-AETQKRHQQLKEEVRKMIVAPMANSTLKLAFIDSVQGLGVSYHF 89          
BLAST of CB304467 vs. ExPASy Swiss-Prot
Match: DCS3_GOSAR ((+)-delta-cadinene synthase isozyme A OS=Gossypium arboreum GN=CAD1-A PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.813e-11
Identity = 35/73 (47.95%), Postives = 46/73 (63.01%), Query Frame = -2
Query:   29 RPTADFHPSLWRNHFLKGASDFKTVDHTATQERHEALKEEVRRMITDAEDKPVQKLRLIDEVQRLGVAYHFEQ 247
            RP ADFHP +W + F+       T    AT+ ++E LK +VR+MI +  D   QKL  ID VQRLGV+YHFE+
Sbjct:   21 RPKADFHPGIWGDMFIICPD---TDIDAATELQYEELKAQVRKMIMEPVDDSNQKLPFIDAVQRLGVSYHFEK 90          
The following BLAST results are available for this feature:
BLAST of CB304467 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
DCS4_GOSAR1.369e-1249.35(+)-delta-cadinene synthase isozyme C2 OS=Gossypiu... [more]
DCS2_GOSAR3.050e-1249.35(+)-delta-cadinene synthase isozyme XC14 OS=Gossyp... [more]
DCS1_GOSAR3.050e-1249.35(+)-delta-cadinene synthase isozyme XC1 OS=Gossypi... [more]
DCS1_GOSHI3.373e-1148.05(+)-delta-cadinene synthase OS=Gossypium hirsutum ... [more]
DCS3_GOSAR9.813e-1147.95(+)-delta-cadinene synthase isozyme A OS=Gossypium... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIaR_C03 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIaR_C03 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304467 ID=CB304467|Name=CB304467|organism=Citrus sinensis|type=EST|length=332bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGCTCAAAGTGATAAGCCACC
CCCAGGCGTTGTACTTCATCAATCAAGCGTAACTTCTGAACAGGCTTATC
TTCAGCATCTGTTATCATTCTCCTTACCTCTTCTTTCAGTGCCTCGTGTC
GTTCTTGAGTTGCAGTATGATCAACTGTCTTGAAATCAGAAGCACCTTTG
AGGAAATGGTTTCTCCATAAACTAGGATGGAAATCTGCAGTAGGACGAAA
TGTTTCTCCAGACGACATTTTTGTGTCAGACAAACGGGTGCTGCAGAATT
TTGATATTTCTGTGGAATTATAATTTGTATCC
back to top