CB304469

Overview
NameCB304469
Unique NameCB304469
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length597
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5271 contig Csv1_Contig5271:333..929. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304469 vs. ExPASy Swiss-Prot
Match: LEA5_CITSI (Late embryogenesis abundant protein Lea5 OS=Citrus sinensis GN=LEA5 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.407e-47
Identity = 95/97 (97.94%), Postives = 95/97 (97.94%), Query Frame = -2
Query:  237 MARSLFKAKLLLAPVADGISLSIGRRGYAAAAPLGTISRTGIMEKNDLTPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 527
            MARSLFKAKLLLAPVADGISLSI RRGYAAAAPLGTISRTGIMEKNDL PAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH
Sbjct:    1 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 97          
BLAST of CB304469 vs. ExPASy Swiss-Prot
Match: LEA5D_GOSHI (Late embryogenesis abundant protein Lea5-D OS=Gossypium hirsutum GN=LEA5-D PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.262e-21
Identity = 56/104 (53.85%), Postives = 69/104 (66.35%), Query Frame = -2
Query:  240 MARSLFKAKLLLAPVADGISLSIGRRGYAAAAPLG---TISRTGIMEKNDLTPAVREDSGA-----SSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRA 527
            MARS+   KLL A + DG+ +SI RRGY+ A P     +  R G M K +   A++E S +     SSAWAPDP+TGYYRPEN   EID AELREMLLNH+VR+
Sbjct:    1 MARSVSSFKLLGASIFDGLYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLNHRVRS 104          
BLAST of CB304469 vs. ExPASy Swiss-Prot
Match: LEA5A_GOSHI (Late embryogenesis abundant protein Lea5-A OS=Gossypium hirsutum GN=LEA5-A PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.621e-19
Identity = 53/104 (50.96%), Postives = 67/104 (64.42%), Query Frame = -2
Query:  240 MARSLFKAKLLLAPVADGISLSIGRRGYAAAAPLG---TISRTGIMEKNDLTPAVREDSGA-----SSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRA 527
            MARS+   K L A V D + +SI RRGY+ A P     +  R G M K +   A++E S +     SSAWAPDP+TGYYRPEN   EID A+LREM+LNH+VR+
Sbjct:    1 MARSVSSFKFLGASVFDALYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRYAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAADLREMMLNHRVRS 104          
BLAST of CB304469 vs. ExPASy Swiss-Prot
Match: ARG2_PHAAU (Indole-3-acetic acid-induced protein ARG2 OS=Phaseolus aureus GN=ARG2 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.175e-11
Identity = 42/97 (43.30%), Postives = 55/97 (56.70%), Query Frame = -2
Query:  249 MARSLFKAKLLLAPVADGISLSIGRRGYAAAAPLG-TISRTGIMEKNDLTPAVREDS---GASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHK 527
            MARS    K+L A VADG S +  R G+AAAA    + +R G     ++ P   E+    G   +W PDP+TGYYRPEN   EID A++R  +L  K
Sbjct:    1 MARSFTNVKVLSALVADGFSNTTTRHGFAAAAAATQSATRGGASIGGNMVPKSGEEKVRGGEKVSWVPDPVTGYYRPEN-TNEIDVADMRATVLGKK 96          
The following BLAST results are available for this feature:
BLAST of CB304469 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
LEA5_CITSI1.407e-4797.94Late embryogenesis abundant protein Lea5 OS=Citrus... [more]
LEA5D_GOSHI2.262e-2153.85Late embryogenesis abundant protein Lea5-D OS=Goss... [more]
LEA5A_GOSHI1.621e-1950.96Late embryogenesis abundant protein Lea5-A OS=Goss... [more]
ARG2_PHAAU6.175e-1143.30Indole-3-acetic acid-induced protein ARG2 OS=Phase... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIaR_C06 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIaR_C06 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304469 ID=CB304469|Name=CB304469|organism=Citrus sinensis|type=EST|length=597bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGCAATACAGGCATTCTTTAC
TTTTATTGACAAGTTAATAGAGACAAAATCATGGAAATGCACTATTAAAA
GTTGTAAATAACAGTTGATATCAAAACAACAGCAAAGACTTTAGAGTGAG
TCAAAATTGCTACTGTAACAACATCACTTAAAAGTTAAAGCACCGCTAAC
AGCAAAGGATCTGCTGCTATGCGCGACCACTCCCTAGTGTGCCCTGACTT
TGTGGTTCAACAGCATCTCTCGAAGCTCTGCTGGATCAATCTCGACCGCC
CGATTCTCCGGCCTGTAGTACCCAGTGATGGGATCTGGGGCCCAGGCAGA
AGAGGCCCCAGAATCCTCTCTCACCGCAGGCGTCAAATCATTTTTCTCCA
TGATACCAGTCCGAGATATGGTTCCTAAGGGTGCTGCTGCAGCATATCCT
CTCCTGCCAATGGAGAGCGAGATGCCATCAGCAACAGGAGCAAGAAGAAG
CTTAGCTTTGAAGAGAGAGCGGGCCATTGTTTTATTTACTTATAGAACTT
AATAGATATGAAGATAGCTAGCTGGGATGTTTCTGTACAGTGCTACT
back to top