CB304472

Overview
NameCB304472
Unique NameCB304472
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length678
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2038 contig Csv1_Contig2038:8..685. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304472 vs. ExPASy Swiss-Prot
Match: G3PC_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Nicotiana tabacum GN=GAPC PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 5.227e-47
Identity = 92/102 (90.20%), Postives = 99/102 (97.06%), Query Frame = -2
Query:  372 MAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSVFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHIA 677
            MAFRVPTVDVSVVDLTVRLEK+ASYD+IKAAIK ESEGKLKGILG+TEDDVVSTDFVGDSRSS+FDAKAGIALSK FVKLVSWYDNEWGYS+RV+DLI H+A
Sbjct:  222 MAFRVPTVDVSVVDLTVRLEKEASYDDIKAAIKEESEGKLKGILGFTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVIDLICHMA 323          
BLAST of CB304472 vs. ExPASy Swiss-Prot
Match: G3PC_GINBI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ginkgo biloba PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.916e-47
Identity = 92/104 (88.46%), Postives = 98/104 (94.23%), Query Frame = -2
Query:  366 MAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSVFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHIAKT 677
            MAFRVPT DVSVVDLTVRLEK ASYDEIKAAIK ESEGKLKGILGYTEDDVVSTDF+GD+RSS+FDAKAGIALS  FVKLVSWYDNEWGYS+RV+DLIVH+A T
Sbjct:  236 MAFRVPTPDVSVVDLTVRLEKPASYDEIKAAIKEESEGKLKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSSRVIDLIVHMAST 339          
BLAST of CB304472 vs. ExPASy Swiss-Prot
Match: G3PC_ANTMA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Antirrhinum majus GN=GAPC PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.164e-46
Identity = 92/105 (87.62%), Postives = 99/105 (94.29%), Query Frame = -2
Query:  363 MAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSVFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHIAKTQ 677
            M+FRVPTVDVSVVDLTVRLEK A+Y++IKAAIK ESEGKLKGILGYTEDDVVSTDFVGDSRSS+FDAKAGIAL+  FVKLVSWYDNEWGYSTRVVDLIVH+A  Q
Sbjct:  233 MSFRVPTVDVSVVDLTVRLEKKATYEQIKAAIKEESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVVDLIVHMASVQ 337          
BLAST of CB304472 vs. ExPASy Swiss-Prot
Match: G3PC_ARATH (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Arabidopsis thaliana GN=GAPC PE=2 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 1.521e-46
Identity = 92/103 (89.32%), Postives = 99/103 (96.12%), Query Frame = -2
Query:  369 MAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSVFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHIAK 677
            M+FRVPTVDVSVVDLTVRLEK A+YDEIK AIK ESEGKLKGILGYTEDDVVSTDFVGD+RSS+FDAKAGIALS KFVKLVSWYDNEWGYS+RVVDLIVH++K
Sbjct:  235 MSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVDLIVHMSK 337          
BLAST of CB304472 vs. ExPASy Swiss-Prot
Match: G3PC_PEA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pisum sativum GN=GAPC1 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.594e-46
Identity = 93/103 (90.29%), Postives = 99/103 (96.12%), Query Frame = -2
Query:  369 MAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSVFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHIAK 677
            M+FRVPTVDVSVVDLTVRLEK A+YDEIKAAIK ESEGKLKGILGYTEDDVVSTDF+GD+RSS+FDAKAGIAL+ KFVKLVSWYDNE GYSTRVVDLIVHIAK
Sbjct:  234 MSFRVPTVDVSVVDLTVRLEKAATYDEIKAAIKEESEGKLKGILGYTEDDVVSTDFIGDTRSSIFDAKAGIALNDKFVKLVSWYDNELGYSTRVVDLIVHIAK 336          
BLAST of CB304472 vs. ExPASy Swiss-Prot
Match: G3PC_PINSY (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pinus sylvestris GN=GAPC PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.425e-46
Identity = 92/105 (87.62%), Postives = 98/105 (93.33%), Query Frame = -2
Query:  363 MAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSVFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHIAKTQ 677
            MAFRVPT DVSVVDLTVRLEK A+YDEIKAAIKAESEG LKGILGYTED VVSTDF+GDSRSS+FDA+AGIALS  FVKLVSWYDNEWGYS+RVVDLIVH+A TQ
Sbjct:  236 MAFRVPTPDVSVVDLTVRLEKSATYDEIKAAIKAESEGNLKGILGYTEDAVVSTDFIGDSRSSIFDAQAGIALSDNFVKLVSWYDNEWGYSSRVVDLIVHMAATQ 340          
BLAST of CB304472 vs. ExPASy Swiss-Prot
Match: G3PC_SINAL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 5.779e-46
Identity = 90/103 (87.38%), Postives = 98/103 (95.15%), Query Frame = -2
Query:  369 MAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSVFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHIAK 677
            M+FRVPTVDVSVVDLTVRLEK A+YDEIK AIK ES+GKLKGILGYTEDDVVSTDFVGD+RSS+FDAKAGIALS  FVKLVSWYDNEWGYSTRVVDLI+H++K
Sbjct:  235 MSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESQGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVDLIIHMSK 337          
BLAST of CB304472 vs. ExPASy Swiss-Prot
Match: G3PC_DIACA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Dianthus caryophyllus GN=GAPC PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.287e-45
Identity = 88/104 (84.62%), Postives = 98/104 (94.23%), Query Frame = -2
Query:  366 MAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSVFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHIAKT 677
            M+FRVPTVDVSVVDLTVR+EK A+Y+++KAAIK ESEGKLKGILGYTEDDVVSTDFVGD+RSS+FDAKAGIAL+  F+KLVSWYDNEWGYSTRVVDLI HI KT
Sbjct:  233 MSFRVPTVDVSVVDLTVRIEKPATYEQVKAAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALNDNFIKLVSWYDNEWGYSTRVVDLIAHIHKT 336          
BLAST of CB304472 vs. ExPASy Swiss-Prot
Match: G3PC_MESCR (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Mesembryanthemum crystallinum GN=GAPC PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.196e-45
Identity = 88/105 (83.81%), Postives = 99/105 (94.29%), Query Frame = -2
Query:  363 MAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSVFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHIAKTQ 677
            MAFRVPT DVSVVDLTVR+EK ASY++IKAAIK ESEGKLKGILGYTEDD+VSTDF+GD+RSS+FDAKAGI+L+  FVKLVSWYDNEWGYSTRVVDLI+HI+K Q
Sbjct:  233 MAFRVPTCDVSVVDLTVRIEKAASYEQIKAAIKEESEGKLKGILGYTEDDLVSTDFIGDNRSSIFDAKAGISLNDNFVKLVSWYDNEWGYSTRVVDLIMHISKCQ 337          
BLAST of CB304472 vs. ExPASy Swiss-Prot
Match: G3PC_CRAPL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.196e-45
Identity = 90/102 (88.24%), Postives = 98/102 (96.08%), Query Frame = -2
Query:  372 MAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSVFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVDLIVHIA 677
            MAFRVPTVDVSVVDLTV L K+ASYDEIKAAIK ESEGKLKGILGYTE+DVVS+DFVGDSRSS+FDAKAGIALSKKFVK+V+WYDNEWGYS+RVVDLI H+A
Sbjct:  233 MAFRVPTVDVSVVDLTVTLAKEASYDEIKAAIKEESEGKLKGILGYTEEDVVSSDFVGDSRSSIFDAKAGIALSKKFVKIVAWYDNEWGYSSRVVDLIRHMA 334          
The following BLAST results are available for this feature:
BLAST of CB304472 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 342
Match NameE-valueIdentityDescription
G3PC_TOBAC5.227e-4790.20Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_GINBI8.916e-4788.46Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ANTMA1.164e-4687.62Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ARATH1.521e-4689.32Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PEA2.594e-4690.29Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PINSY4.425e-4687.62Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_SINAL5.779e-4687.38Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_DIACA1.287e-4584.62Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_MESCR2.196e-4583.81Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_CRAPL2.196e-4588.24Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIaR_C09 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIaR_C09 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304472 ID=CB304472|Name=CB304472|organism=Citrus sinensis|type=EST|length=678bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGCGTACATAATCGTGAGAG
AATGAAATAACAGCTGAAGAACAGGGCTTCGATACTAACTAGATGAAAAA
TTATAAAAGCAAGTTTCCAATAGACAATTGTTTTCTCGCTAACAAAACAT
AAGTTGGTTCACCAACTCTTCTTGCATACTACAAGGGAAAATCTAAGCAC
AACCCTGCATGAGCAGGTAAGGCTCTGGATAATGTCTTGGAAACAATTTT
ATTTAAACTCAGACCCTCTACATAGAAACACAAACACCACATTTAGCGCA
AAGAAACACCACACTTAGCACAACTAAGCGTGTTACATACTCAAGCCACG
CCGAGTAAGTTACTGGGTCTTCGCTATGTGGACAATCAAATCCACCACAC
GAGTACTGTAGCCCCACTCATTGTCATACCATGAGACAAGCTTCACAAAT
TTCTTACTCAAAGCAATACCAGCCTTGGCATCAAAGACACTTGACCTACT
GTCACCAACAAAGTCGGTGGATACCACATCATCCTCAGTGTATCCCAAGA
TACCCTTTAGTTTCCCCTCTGACTCCGCCTTGATGGCAGCTTTGATTTCA
TCATAAGAAGCGTCCTTCTCCAGCCTCACTGTGAGGTCAACCACTGAGAC
ATCAACAGTGGGTACACGGAAAGCCATA
back to top