CB305012

Overview
NameCB305012
Unique NameCB305012
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length579
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2325 contig Csv1_Contig2325:131..710. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB305012 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 2.639e-58
Identity = 74/76 (97.37%), Postives = 76/76 (100.00%), Query Frame = -1
Query:  217 KFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 444
            KF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNVEKKDP
Sbjct:  359 KFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 434          

HSP 2 Score: 93.9745 bits (232), Expect = 2.639e-58
Identity = 43/45 (95.56%), Postives = 45/45 (100.00%), Query Frame = -3
Query:  443 SNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 577
            SNSKDDPA+EAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK
Sbjct:  315 SNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 359          
BLAST of CB305012 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.296e-57
Identity = 70/76 (92.11%), Postives = 76/76 (100.00%), Query Frame = -1
Query:  217 KFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 444
            KF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  359 KFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          

HSP 2 Score: 95.9005 bits (237), Expect = 1.296e-57
Identity = 44/45 (97.78%), Postives = 45/45 (100.00%), Query Frame = -3
Query:  443 SNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 577
            SNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK
Sbjct:  315 SNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 359          
BLAST of CB305012 vs. ExPASy Swiss-Prot
Match: EF1A_PEA (Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.872e-57
Identity = 70/76 (92.11%), Postives = 76/76 (100.00%), Query Frame = -1
Query:  217 KFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 444
            KF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  359 KFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          

HSP 2 Score: 94.7449 bits (234), Expect = 2.872e-57
Identity = 43/45 (95.56%), Postives = 45/45 (100.00%), Query Frame = -3
Query:  443 SNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 577
            SNSKDDPA++AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK
Sbjct:  315 SNSKDDPAKDAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 359          
BLAST of CB305012 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 3.745e-57
Identity = 72/76 (94.74%), Postives = 75/76 (98.68%), Query Frame = -1
Query:  217 KFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 444
            KF+EL+TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNVEKKDP
Sbjct:  359 KFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 434          

HSP 2 Score: 93.2041 bits (230), Expect = 3.745e-57
Identity = 42/45 (93.33%), Postives = 45/45 (100.00%), Query Frame = -3
Query:  443 SNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 577
            SNSKDDPA+EAANFT+QVII+NHPGQIGNGYAPVLDCHTSHIAVK
Sbjct:  315 SNSKDDPAKEAANFTAQVIIINHPGQIGNGYAPVLDCHTSHIAVK 359          
BLAST of CB305012 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.082e-56
Identity = 70/76 (92.11%), Postives = 74/76 (97.37%), Query Frame = -1
Query:  217 KFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 444
            KF+E++TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          

HSP 2 Score: 95.9005 bits (237), Expect = 1.082e-56
Identity = 44/45 (97.78%), Postives = 45/45 (100.00%), Query Frame = -3
Query:  443 SNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 577
            SNSKDDPA+EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK
Sbjct:  315 SNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 359          
BLAST of CB305012 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.082e-56
Identity = 72/76 (94.74%), Postives = 75/76 (98.68%), Query Frame = -1
Query:  217 KFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 444
            KF+ELVTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  359 KFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          

HSP 2 Score: 91.6633 bits (226), Expect = 1.082e-56
Identity = 42/45 (93.33%), Postives = 44/45 (97.78%), Query Frame = -3
Query:  443 SNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 577
            S SKDDPA+EAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK
Sbjct:  315 SGSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 359          
BLAST of CB305012 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 2.397e-56
Identity = 70/76 (92.11%), Postives = 76/76 (100.00%), Query Frame = -1
Query:  217 KFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 444
            KF+E++TKIDRRSGKE+EKEPKFLKNGDAGMVKMIPTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKDP
Sbjct:  359 KFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP 434          

HSP 2 Score: 91.2781 bits (225), Expect = 2.397e-56
Identity = 42/45 (93.33%), Postives = 44/45 (97.78%), Query Frame = -3
Query:  443 SNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 577
            SNSKDDPA+ AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK
Sbjct:  315 SNSKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 359          
BLAST of CB305012 vs. ExPASy Swiss-Prot
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 4.074e-56
Identity = 69/76 (90.79%), Postives = 75/76 (98.68%), Query Frame = -1
Query:  217 KFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 444
            KFSE++TKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP
Sbjct:  359 KFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDP 434          

HSP 2 Score: 93.2041 bits (230), Expect = 4.074e-56
Identity = 43/45 (95.56%), Postives = 44/45 (97.78%), Query Frame = -3
Query:  443 SNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 577
            SNSKDDPA+ AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK
Sbjct:  315 SNSKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 359          
BLAST of CB305012 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 9.027e-56
Identity = 69/76 (90.79%), Postives = 76/76 (100.00%), Query Frame = -1
Query:  217 KFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 444
            KF+E++TKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF++YPPLGRFAVRDMRQTVAVGV+KNV+KKDP
Sbjct:  359 KFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDP 434          

HSP 2 Score: 90.1225 bits (222), Expect = 9.027e-56
Identity = 41/45 (91.11%), Postives = 44/45 (97.78%), Query Frame = -3
Query:  443 SNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 577
            SNSKDDPA+ AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVK
Sbjct:  315 SNSKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 359          
BLAST of CB305012 vs. ExPASy Swiss-Prot
Match: EF1A2_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.177e-55
Identity = 69/76 (90.79%), Postives = 72/76 (94.74%), Query Frame = -1
Query:  217 KFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 444
            KF+E+ TKIDRRSGKELEKEPKFLKNGDAG VKMIPTKPMVVETF  YPPLGRFAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  359 KFAEIQTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFMSYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          

HSP 2 Score: 94.7449 bits (234), Expect = 1.177e-55
Identity = 43/45 (95.56%), Postives = 45/45 (100.00%), Query Frame = -3
Query:  443 SNSKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 577
            SNSKDDPA+EAANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVK
Sbjct:  315 SNSKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVK 359          
The following BLAST results are available for this feature:
BLAST of CB305012 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 158
Match NameE-valueIdentityDescription
EF1A_ORYSJ2.639e-5897.37Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_VICFA1.296e-5792.11Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A_PEA2.872e-5792.11Elongation factor 1-alpha OS=Pisum sativum PE=2 SV... [more]
EF1A_SOYBN3.745e-5794.74Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_MANES1.082e-5692.11Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A_MAIZE1.082e-5694.74Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_TOBAC2.397e-5692.11Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_ARATH4.074e-5690.79Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A_SOLLC9.027e-5690.79Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A2_DAUCA1.177e-5590.79Elongation factor 1-alpha OS=Daucus carota PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0003_IIaR_G01 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0003_IIaR_G01 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB305012 ID=CB305012|Name=CB305012|organism=Citrus sinensis|type=EST|length=579bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTACCAACTTACCAAAAAAAAAC
TCTGATATAAAACCAAATTCAGAGAATTAAAATGAAGTCCCGTAAAACAA
ACTAAAACACGACAAAAATAGCATAAACAGAGAAAATAAAAGCTAACTAT
AGCAGATAGATCCCAAAAAACTCCTCACTTCTTCTTGGCTGCAGACTTGG
TGACCTTGGCACCTGTTGGATCCTTCTTTTCAACATTCTTAATCACACCA
ACAGCAACAGTCTGACGCATGTCCCTAACGGCAAAACGACCAAGAGGTGG
GTAGTCAGAGAAGGTTTCAACAACCATGGGCTTGGTGGGAATCATCTTAA
CCATTCCAGCATCTCCATTCTTCAAGAACTTGGGCTCCTTCTCAAGCTCC
TTGCCTGATCGCCTATCAATCTTCGTCACGAGCTCAGAAAACTTTGACGG
CAATGTGGGAGGTGTGGCAGTCAAGCACTGGGGCATATCCATTTCCAATC
TGGCCAGGGTGGTTCATGATGATGACCTGTGAGGTGAAGTTGGCAGCTTC
CCTGGCTGGATCATCCTTCGAGTTGGAAG
back to top