CB305020
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB305020 vs. ExPASy Swiss-Prot
Match: ERD2_PETHY (ER lumen protein retaining receptor OS=Petunia hybrida GN=ERD2 PE=2 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 4.766e-12 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = -3 Query: 128 WLSGLAQTALYADFFYYYIKSWKNRELLKLPA 223 W++GL QT LYADFFYYY +SWKN L+LPA Sbjct: 184 WIAGLIQTLLYADFFYYYFQSWKNNTKLELPA 215 HSP 2 Score: 36.5798 bits (83), Expect = 4.766e-12 Identity = 13/21 (61.90%), Postives = 16/21 (76.19%), Query Frame = -2 Query: 312 ALYILNWVYRFYVEDHKVRWI 374 + YILNWVYR++ E H V WI Sbjct: 162 SFYILNWVYRYFTEPHFVHWI 182
BLAST of CB305020 vs. ExPASy Swiss-Prot
Match: ERD2_ARATH (ER lumen protein retaining receptor OS=Arabidopsis thaliana GN=ERD2 PE=2 SV=1) HSP 1 Score: 51.6026 bits (122), Expect = 4.766e-12 Identity = 24/33 (72.73%), Postives = 25/33 (75.76%), Query Frame = -3 Query: 128 AWLSGLAQTALYADFFYYYIKSWKNRELLKLPA 226 A +SGL QTALYADFFYYY SWK LKLPA Sbjct: 183 ACVSGLVQTALYADFFYYYYISWKTNTKLKLPA 215 HSP 2 Score: 39.6614 bits (91), Expect = 4.766e-12 Identity = 13/20 (65.00%), Postives = 17/20 (85.00%), Query Frame = -2 Query: 312 LYILNWVYRFYVEDHKVRWI 371 LYI+NW+YR++ EDH RWI Sbjct: 163 LYIINWIYRYFTEDHFTRWI 182 The following BLAST results are available for this feature:
BLAST of CB305020 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB305020 ID=CB305020; Name=CB305020; organism=Citrus sinensis; type=EST; length=375bpback to top |