CB305031

Overview
NameCB305031
Unique NameCB305031
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length539
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9763 contig Csv1_Contig9763:466..1004. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB305031 vs. ExPASy Swiss-Prot
Match: MTF1_PEA (MADS-box transcription factor 1 OS=Pisum sativum GN=MTF1 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.860e-26
Identity = 65/114 (57.02%), Postives = 73/114 (64.04%), Query Frame = -3
Query:  205 QYMLDTLTELQHKEQLLSEANKTLKQRTMTLRHAAFAGLQLMEGYQVNTLQLNPSAEDCGYGLK-PAQPQGDSFFHA--LECEPTLQIGYQPADPISVVTAGPSLNNYMHGWLP 537
            Q+MLD L +LQ KE LL EAN+ L+QR              MEGYQ+N+LQLN SAED GYG        GD  F    +ECEPTLQIGY   DP SVVTAGPS+NNYM GWLP
Sbjct:  148 QFMLDQLGDLQRKEHLLCEANRALRQR--------------MEGYQINSLQLNLSAEDMGYGRHHQGHTHGDELFQVQPIECEPTLQIGYHQGDPGSVVTAGPSMNNYMGGWLP 247          
BLAST of CB305031 vs. ExPASy Swiss-Prot
Match: AGL9_PETHY (Agamous-like MADS-box protein AGL9 homolog OS=Petunia hybrida GN=FBP2 PE=1 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 7.068e-26
Identity = 65/111 (58.56%), Postives = 74/111 (66.67%), Query Frame = -3
Query:  205 QYMLDTLTELQHKEQLLSEANKTLKQRTMTLRHAAFAGLQLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDSFFHALECEPTLQIGYQPADPISVVTAGPSLNNYMHGWLP 537
            Q MLD L +LQ KE  L+EAN+TLKQR             LMEG  +N LQ   +A+D GYG +  Q QGD FFH LECEPTLQIGYQ  DPI+V  AGPS+NNYM GWLP
Sbjct:  146 QLMLDQLQDLQRKEHALNEANRTLKQR-------------LMEGSTLN-LQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQ-NDPITVGGAGPSVNNYMAGWLP 241          
BLAST of CB305031 vs. ExPASy Swiss-Prot
Match: SEP3_ARATH (Developmental protein SEPALLATA 3 OS=Arabidopsis thaliana GN=SEP3 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.692e-17
Identity = 55/114 (48.25%), Postives = 69/114 (60.53%), Query Frame = -3
Query:  205 QYMLDTLTELQHKEQLLSEANKTLKQRTMTLRHAAFAGLQLMEGYQVNTLQLNPSAEDCG-YGLKPAQPQ--GDSFFHALECEPTLQIGYQPADPISVVTAGPSLNNYMHGWLP 537
            Q+MLD L +LQ KE++L+E NKTL+             L+L +GYQ+  LQLNP+ E+   YG    Q Q    +FF  LECEP LQIGYQ       + AGPS+NNYM GWLP
Sbjct:  148 QFMLDQLNDLQSKERMLTETNKTLR-------------LRLADGYQM-PLQLNPNQEEVDHYGRHHHQQQQHSQAFFQPLECEPILQIGYQGQQ--DGMGAGPSVNNYMLGWLP 245          
BLAST of CB305031 vs. ExPASy Swiss-Prot
Match: AGL9_SINAL (Agamous-like MADS-box protein AGL9 homolog OS=Sinapis alba GN=AGL9 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.692e-17
Identity = 56/116 (48.28%), Postives = 69/116 (59.48%), Query Frame = -3
Query:  205 QYMLDTLTELQHKEQLLSEANKTLKQRTMTLRHAAFAGLQLMEGYQVNTLQLNPSAED--CGYGLKPAQPQGDS---FFHALECEPTLQIGYQPADPISVVTAGPSLNNYMHGWLP 537
            Q+MLD L +LQ KE++L+E NKTL+             L+L +GYQ+  LQLNP+ ED    YG    Q Q +S   FF  LECEP LQ+GYQ       + AGPS NNYM GWLP
Sbjct:  148 QFMLDQLNDLQSKERMLNETNKTLR-------------LRLADGYQM-PLQLNPNQEDHHVDYGRHDQQQQQNSHHAFFQPLECEPILQMGYQGQQDHG-MEAGPSENNYMLGWLP 248          
BLAST of CB305031 vs. ExPASy Swiss-Prot
Match: AGL9_ARADE (Agamous-like MADS-box protein AGL9 homolog OS=Aranda deborah PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.833e-17
Identity = 53/113 (46.90%), Postives = 68/113 (60.18%), Query Frame = -3
Query:  208 QYMLDTLTELQHKEQLLSEANKTLKQRTMTLRHAAFAGLQLMEGYQVNTLQL-NPS-AEDCGYGLKPAQPQGDSFFHALECEPTLQIGYQPADPISVVTAGPSLNNYM-HGWL 537
            Q+MLD L +LQ +EQ+L EANKTLK+R               E  Q N  Q+ +PS     GYG +PAQ  G++F+H LECEPTLQIGY     ++  TA  ++NNYM  GWL
Sbjct:  144 QFMLDQLADLQRREQMLCEANKTLKRR-------------FEESSQANQQQVWDPSNTHAVGYGRQPAQHHGEAFYHPLECEPTLQIGYHSDITMATATAS-TVNNYMPPGWL 242          
The following BLAST results are available for this feature:
BLAST of CB305031 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
MTF1_PEA1.860e-2657.02MADS-box transcription factor 1 OS=Pisum sativum G... [more]
AGL9_PETHY7.068e-2658.56Agamous-like MADS-box protein AGL9 homolog OS=Petu... [more]
SEP3_ARATH2.692e-1748.25Developmental protein SEPALLATA 3 OS=Arabidopsis t... [more]
AGL9_SINAL2.692e-1748.28Agamous-like MADS-box protein AGL9 homolog OS=Sina... [more]
AGL9_ARADE7.833e-1746.90Agamous-like MADS-box protein AGL9 homolog OS=Aran... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0003_IVaR_B03 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0003_IVaR_B03 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB305031 ID=CB305031|Name=CB305031|organism=Citrus sinensis|type=EST|length=539bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTATCGTCATCAGTTTCCCTA
AAGTGCAGGATCACTGTAGAGTTATTATAATAAATCCTTATGATTGCGTG
TTCCTAGTCACTGAATAGGGTTGCTTACAAAGGGATACAAAGTTGCTGAT
TCTTATGGATCAACTACAATACATTGACTGGTAATGCCCGCCGCTCTCTT
AGCATGGTAGCCATCCATGCATGTAATTATTCAGACTCGGGCCTGCTGTG
ACAACCGATATTGGGTCCGCAGGCTGGTATCCAATTTGCAATGTGGGTTC
ACATTCCAAGGCGTGAAAGAAGCTATCGCCCTGAGGTTGAGCTGGTTTAA
GCCCATAACCACAATCTTCTGCACTAGGATTCAATTGAAGTGTGTTCACT
TGGTATCCCTCCATCAACTGCAAACCAGCAAAAGCGGCGTGCCTTAGCGT
CATCGTCCTTTGTTTGAGGGTCTTATTTGCTTCGCTCAGCAACTGTTCCT
TATGTTGCAGTTCAGTAAGGGTATCCAGCATGTACTGAG
back to top