CB305043

Overview
NameCB305043
Unique NameCB305043
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13484 contig Csv1_Contig13484:310..955. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB305043 vs. ExPASy Swiss-Prot
Match: PSY_ARATH (Phytoene synthase, chloroplastic OS=Arabidopsis thaliana GN=PSY1 PE=2 SV=2)

HSP 1 Score: 294.278 bits (752), Expect = 3.662e-79
Identity = 147/168 (87.50%), Postives = 157/168 (93.45%), Query Frame = -1
Query:  143 LYCYYVAGTVGLMSVPVMGIAPDSQATTESVYNAALALGIANQLTNILRDVGEDAQRGRVYLPQDELAQAGLSDDDIFAGEVTNTWRNSMKNQIKRARMFFDMAENGVTELSEASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKIAALPIAYAKSLLRPS 646
            LYCYYVAGTVGLMSVPVMGI P S+ATTESVYNAALALGIANQLTNILRDVGEDA+RGRVYLPQDELAQAGLSD+DIFAG+VT+ WRN MK Q+KRARMFFD AE GVTELS ASRWPVWASLLLYR+ILDEIEANDYNNFTKRAYV K KKIAALP+AYAKS+L+ S
Sbjct:  249 LYCYYVAGTVGLMSVPVMGIDPKSKATTESVYNAALALGIANQLTNILRDVGEDARRGRVYLPQDELAQAGLSDEDIFAGKVTDKWRNFMKMQLKRARMFFDEAEKGVTELSAASRWPVWASLLLYRRILDEIEANDYNNFTKRAYVGKVKKIAALPLAYAKSVLKTS 416          
BLAST of CB305043 vs. ExPASy Swiss-Prot
Match: PSY_MAIZE (Phytoene synthase, chloroplastic OS=Zea mays GN=Y1 PE=3 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 2.009e-77
Identity = 142/167 (85.03%), Postives = 153/167 (91.62%), Query Frame = -1
Query:  146 LYCYYVAGTVGLMSVPVMGIAPDSQATTESVYNAALALGIANQLTNILRDVGEDAQRGRVYLPQDELAQAGLSDDDIFAGEVTNTWRNSMKNQIKRARMFFDMAENGVTELSEASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKIAALPIAYAKSLLRP 646
            +YCYYVAGTVGLMSVPVMGIA +S+ATTESVY+AALALGIANQLTNILRDVGEDA+RGR+YLPQDELAQAGLSD+DIF G VTN WRN MK QIKRARMFF+ AE GV ELS+ASRWPVWASLLLYRQILDEIEANDYNNFTKRAYV K KK+ ALP+AY KSLL P
Sbjct:  236 MYCYYVAGTVGLMSVPVMGIATESKATTESVYSAALALGIANQLTNILRDVGEDARRGRIYLPQDELAQAGLSDEDIFKGVVTNRWRNFMKRQIKRARMFFEEAERGVNELSQASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVGKGKKLLALPVAYGKSLLLP 402          
BLAST of CB305043 vs. ExPASy Swiss-Prot
Match: PSY_CUCME (Phytoene synthase, chloroplastic OS=Cucumis melo GN=PSY PE=2 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 2.009e-77
Identity = 145/169 (85.80%), Postives = 157/169 (92.90%), Query Frame = -1
Query:  143 LYCYYVAGTVGLMSVPVMGIAPDSQATTESVYNAALALGIANQLT-NILRDVGEDAQRGRVYLPQDELAQAGLSDDDIFAGEVTNTWRNSMKNQIKRARMFFDMAENGVTELSEASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKIAALPIAYAKSLLRPS 646
            LYCYYVAGTVGLMSVPVMGIAP+SQA+TESVYNAALALGIANQ   NILRDVGEDA+RGR+YLPQDELAQAGLSD+DIFAG VT+ WRN MKNQIKRARMFFD AE GV EL++ASRWPVWASLLLYRQILDEIEANDY+NFTKRAYVSKAKKI ALP+AY ++LL PS
Sbjct:  254 LYCYYVAGTVGLMSVPVMGIAPESQASTESVYNAALALGIANQAPPNILRDVGEDARRGRIYLPQDELAQAGLSDEDIFAGRVTDKWRNFMKNQIKRARMFFDEAEKGVLELNKASRWPVWASLLLYRQILDEIEANDYDNFTKRAYVSKAKKILALPMAYGRALLGPS 422          
BLAST of CB305043 vs. ExPASy Swiss-Prot
Match: PSY_NARPS (Phytoene synthase, chloroplastic OS=Narcissus pseudonarcissus GN=PSY PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 5.846e-77
Identity = 140/167 (83.83%), Postives = 154/167 (92.22%), Query Frame = -1
Query:  146 LYCYYVAGTVGLMSVPVMGIAPDSQATTESVYNAALALGIANQLTNILRDVGEDAQRGRVYLPQDELAQAGLSDDDIFAGEVTNTWRNSMKNQIKRARMFFDMAENGVTELSEASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKIAALPIAYAKSLLRP 646
            LYCYYVAGTVGLMSVPVMGIAP+S A  ESVYNAALALGIANQLTNILRDVGEDA+RGR+YLPQDELA+AGLSD+D+F G+VT+ WR+ MK QIKRAR FF+ AE GVTELS+ASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSK K++AALP+AY KSLL P
Sbjct:  246 LYCYYVAGTVGLMSVPVMGIAPESLAEAESVYNAALALGIANQLTNILRDVGEDARRGRIYLPQDELAEAGLSDEDVFTGKVTDKWRSFMKRQIKRARTFFEQAEKGVTELSQASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKVKRLAALPLAYGKSLLIP 412          
BLAST of CB305043 vs. ExPASy Swiss-Prot
Match: PSY1_SOLLC (Phytoene synthase 1, chloroplastic OS=Solanum lycopersicum GN=PSY1 PE=1 SV=2)

HSP 1 Score: 286.96 bits (733), Expect = 5.846e-77
Identity = 143/169 (84.62%), Postives = 157/169 (92.90%), Query Frame = -1
Query:  140 LYCYYVAGTVGLMSVPVMGIAPDSQATTESVYNAALALGIANQLTNILRDVGEDAQRGRVYLPQDELAQAGLSDDDIFAGEVTNTWRNSMKNQIKRARMFFDMAENGVTELSEASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKIAALPIAYAKSLLRPSR 646
            LYCYYVAGTVGLMSVP+MGIAP+S+ATTESVYNAALALGIANQLTNILRDVGEDA+RGRVYLPQDELAQAGLSD+DIFAG VT+ WR  MK QI RAR FFD AE GVTELS ASR+PVWASL+LYR+ILDEIEANDYNNFTKRAYVSK+KK+ ALPIAYAKSL+ P++
Sbjct:  238 LYCYYVAGTVGLMSVPIMGIAPESKATTESVYNAALALGIANQLTNILRDVGEDARRGRVYLPQDELAQAGLSDEDIFAGRVTDKWRIFMKKQIHRARKFFDEAEKGVTELSSASRFPVWASLVLYRKILDEIEANDYNNFTKRAYVSKSKKLIALPIAYAKSLVPPTK 406          
BLAST of CB305043 vs. ExPASy Swiss-Prot
Match: PSY_CAPAN (Phytoene synthase, chloroplastic OS=Capsicum annuum GN=PSY1 PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 2.901e-76
Identity = 144/169 (85.21%), Postives = 155/169 (91.72%), Query Frame = -1
Query:  140 LYCYYVAGTVGLMSVPVMGIAPDSQATTESVYNAALALGIANQLTNILRDVGEDAQRGRVYLPQDELAQAGLSDDDIFAGEVTNTWRNSMKNQIKRARMFFDMAENGVTELSEASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKIAALPIAYAKSLLRPSR 646
            LYCYYVAGTVGLMSVP+MGIAP+S+ATTESVYNAALALGIANQLTNILRDVGEDA+RGRVYLPQDELAQAGLSD+DIFAG VT+ WR  MK QI+RAR FFD AE GVTELS ASRWPV ASLLLYR+ILDEIEANDYNNFTKRAYVSK KK+ ALPIAYAKSL+  +R
Sbjct:  250 LYCYYVAGTVGLMSVPIMGIAPESKATTESVYNAALALGIANQLTNILRDVGEDARRGRVYLPQDELAQAGLSDEDIFAGRVTDKWRIFMKKQIQRARKFFDEAEKGVTELSAASRWPVLASLLLYRRILDEIEANDYNNFTKRAYVSKPKKLIALPIAYAKSLVPSTR 418          
BLAST of CB305043 vs. ExPASy Swiss-Prot
Match: PSY2_SOLLC (Phytoene synthase 2, chloroplastic (Fragment) OS=Solanum lycopersicum GN=PSY2 PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 1.440e-75
Identity = 141/167 (84.43%), Postives = 154/167 (92.22%), Query Frame = -1
Query:  146 LYCYYVAGTVGLMSVPVMGIAPDSQATTESVYNAALALGIANQLTNILRDVGEDAQRGRVYLPQDELAQAGLSDDDIFAGEVTNTWRNSMKNQIKRARMFFDMAENGVTELSEASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKIAALPIAYAKSLLRP 646
            LYCYYVAGTVGLMSVP+MGIAP+S+ATTESVYNAALALGIANQLTNILRDVGEDA+RGRVYLPQDELAQAGLSD+DIFAG+VT+ WR  MK QI+RAR FFD AE GVTELS ASRWPV ASLLLYR+ILDEIEANDYNNFT+RAYVSK KK+  LPIAYA+SL+ P
Sbjct:  134 LYCYYVAGTVGLMSVPIMGIAPESKATTESVYNAALALGIANQLTNILRDVGEDARRGRVYLPQDELAQAGLSDEDIFAGKVTDKWRIFMKKQIQRARKFFDEAEKGVTELSSASRWPVLASLLLYRKILDEIEANDYNNFTRRAYVSKPKKLLTLPIAYARSLVPP 300          
BLAST of CB305043 vs. ExPASy Swiss-Prot
Match: PSY_DAUCA (Phytoene synthase, chloroplastic OS=Daucus carota GN=PSY PE=2 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 5.662e-72
Identity = 131/170 (77.06%), Postives = 152/170 (89.41%), Query Frame = -1
Query:  137 LYCYYVAGTVGLMSVPVMGIAPDSQATTESVYNAALALGIANQLTNILRDVGEDAQRGRVYLPQDELAQAGLSDDDIFAGEVTNTWRNSMKNQIKRARMFFDMAENGVTELSEASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKIAALPIAYAKSLLRPSRI 646
            LYCYYVAGTVGLMSVPVMGIAP+S+ATTESVY+AALALGIANQLTNILRDVGEDA+RGR+YLPQ+EL  AG++ + IF G+VT+ WR+ MK QIKRARMFFD AE GV ELS ASRWPVWASLLLY+QILD IEANDY+NFTKRAYV KAKK+ +LP+AY+++L  PS +
Sbjct:  228 LYCYYVAGTVGLMSVPVMGIAPESKATTESVYSAALALGIANQLTNILRDVGEDARRGRIYLPQEELKLAGITPEYIFKGKVTDKWRSFMKGQIKRARMFFDEAEKGVAELSSASRWPVWASLLLYKQILDAIEANDYDNFTKRAYVGKAKKLVSLPLAYSRALFAPSTV 397          
BLAST of CB305043 vs. ExPASy Swiss-Prot
Match: CRTB_SYNE7 (Phytoene synthase OS=Synechococcus elongatus (strain PCC 7942) GN=crtB PE=3 SV=2)

HSP 1 Score: 190.66 bits (483), Expect = 5.702e-48
Identity = 97/168 (57.74%), Postives = 121/168 (72.02%), Query Frame = -1
Query:  158 YCYYVAGTVGLMSVPVMGI------APDSQATTESVYNAALALGIANQLTNILRDVGEDAQRGRVYLPQDELAQAGLSDDDIFAGEVTNTWRNSMKNQIKRARMFFDMAENGVTELSEASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKIAALPIAYAKS 643
            YCY VAGTVGLMS PVMGI      AP    T       ALALGIANQLTNILRDVGEDA+RGR+YLPQ+ELAQ   S+ D+F G + + WR  M+ Q+ RAR +F+ AE G+ +LS  +RWPVWASL+LYR+ILD IE N+Y+ F KRAYV   +K+ +LP+A  ++
Sbjct:  138 YCYRVAGTVGLMSQPVMGIESTNSRAPWDPTTPPDPTQEALALGIANQLTNILRDVGEDARRGRIYLPQEELAQFNYSEQDLFNGVIDDRWRAFMQFQLDRARDYFEQAERGIRQLSHDARWPVWASLMLYREILDVIEQNNYDVFRKRAYVPTWRKLCSLPVAMLRA 305          
BLAST of CB305043 vs. ExPASy Swiss-Prot
Match: CRTY_SPIPL (Phytoene synthase OS=Spirulina platensis GN=crtB PE=3 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.242e-44
Identity = 94/170 (55.29%), Postives = 119/170 (70.00%), Query Frame = -1
Query:  158 LYCYYVAGTVGLMSVPVMGIA-PDSQAT---TESVY---NAALALGIANQLTNILRDVGEDAQRGRVYLPQDELAQAGLSDDDIFAGEVTNTWRNSMKNQIKRARMFFDMAENGVTELSEASRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKIAALPIAYAKS 646
            LYCY VAGTVGLMS+ VMG A PD        +S+Y     A+ALGIANQLTNILRDVGEDA+RGR+YLP D+LA    ++ D+  G+V   WR  M+ QI+RAR F+ +AE G+  L    RWPVW +L+LYRQILDEIE N+Y+ F +RAYV   KK+  LP+A  ++
Sbjct:  137 LYCYRVAGTVGLMSLAVMGTAEPDLSVPWNRDQSIYYPKEEAIALGIANQLTNILRDVGEDARRGRIYLPLDDLALFNYTEADLLNGKVDERWRELMRFQIQRARKFYTLAEEGIAALHPDIRWPVWTALMLYRQILDEIERNEYDVFNQRAYVPTWKKMMCLPLAQLRA 306          
The following BLAST results are available for this feature:
BLAST of CB305043 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 29
Match NameE-valueIdentityDescription
PSY_ARATH3.662e-7987.50Phytoene synthase, chloroplastic OS=Arabidopsis th... [more]
PSY_MAIZE2.009e-7785.03Phytoene synthase, chloroplastic OS=Zea mays GN=Y1... [more]
PSY_CUCME2.009e-7785.80Phytoene synthase, chloroplastic OS=Cucumis melo G... [more]
PSY_NARPS5.846e-7783.83Phytoene synthase, chloroplastic OS=Narcissus pseu... [more]
PSY1_SOLLC5.846e-7784.62Phytoene synthase 1, chloroplastic OS=Solanum lyco... [more]
PSY_CAPAN2.901e-7685.21Phytoene synthase, chloroplastic OS=Capsicum annuu... [more]
PSY2_SOLLC1.440e-7584.43Phytoene synthase 2, chloroplastic (Fragment) OS=S... [more]
PSY_DAUCA5.662e-7277.06Phytoene synthase, chloroplastic OS=Daucus carota ... [more]
CRTB_SYNE75.702e-4857.74Phytoene synthase OS=Synechococcus elongatus (stra... [more]
CRTY_SPIPL2.242e-4455.29Phytoene synthase OS=Spirulina platensis GN=crtB P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0003_IVaR_C09 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0003_IVaR_C09 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB305043 ID=CB305043|Name=CB305043|organism=Citrus sinensis|type=EST|length=646bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTCGATATCCAAGCAATCATTTTC
ATGTTTGTTTCCACTTTGAATCCGTTTCAACTATATATGCTTCTAAACTT
TGATGTTAAATGTTCAGTTTAAGCCTTACTGGTATATATTCTTGACGGGC
GTAAGAGGGATTTTGCATATGCAATTGGTAGTGCAGCTATCTTCTTGGCT
TTACTCACATAAGCTCTCTTTGTGAAGTTGTTGTAATCATTGGCCTCAAT
CTCATCCAGTATTTGCCGGTACAACAGCAATGAAGCCCATACCGGCCATC
TACTAGCTTCACTCAGCTCGGTCACACCGTTCTCAGCCATATCAAAGAAC
ATCCTTGCCCTCTTAATTTGGTTCTTCATGGAGTTTCTCCATGTATTAGT
CACTTCTCCAGCAAATATGTCATCATCTGAAAGCCCCGCCTGTGCCAACT
CATCTTGTGGTAGATAAACCCTTCCTCTTTGGGCATCCTCTCCAACATCT
CTGAGTATGTTAGTGAGCTGATTAGCAATCCCTAGTGCCAATGCTGCATT
GTAGACGCTCTCTGTTGTTGCCTGTGAGTCAGGTGCTATGCCCATAACTG
GAACACTCATTAGCCCTACGGTCCCAGCAACATAATAACAATACAA
back to top