CF832020

Overview
NameCF832020
Unique NameCF832020
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length840
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6288 contig Csv1_Contig6288:778..1617. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDI_RICCO (Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 2.129e-57
Identity = 109/157 (69.43%), Postives = 126/157 (80.25%), Query Frame = -2
Query:  369 DADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKDEL 839
            + D IAPWVK YKEGKV  +RKS              VAD+LQD+VFNSGKNVLLEFYAPWCGHCK+LAPILDEVAVSY++DAD+VIAK DATANDIP DTF+V+GYPTV+FRSASGK   Y+GDRTK+DI+ FIE NRDKAA +E+    +GKDEL
Sbjct:  345 EPDHIAPWVKAYKEGKVQAYRKSEPIPEVNNEPVKVVVADTLQDIVFNSGKNVLLEFYAPWCGHCKQLAPILDEVAVSYKSDADIVIAKLDATANDIPSDTFDVRGYPTVYFRSASGKVEQYDGDRTKDDIISFIEKNRDKAAQQESA---NGKDEL 498          

HSP 2 Score: 67.781 bits (164), Expect = 8.764e-11
Identity = 34/95 (35.79%), Postives = 57/95 (60.00%), Query Frame = -2
Query:  411 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTVFFRSASGKTV-PYEGDRTKEDIVDFIENNRDKAA 683
            +++EFYAPWCGHCKKL P  ++ A +   +D  VV+AK DA   AN      ++++G+PT+      GK++  Y+G R  + I ++++     A+
Sbjct:   52 IVVEFYAPWCGHCKKLRPEYEKAASILKSHDIPVVLAKVDANEEANKELATQYDIKGFPTLKILRNGGKSIQEYKGPREADGIAEYLKKQSGPAS 146          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDI_MEDSA (Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 5.615e-50
Identity = 100/167 (59.88%), Postives = 120/167 (71.86%), Query Frame = -2
Query:  369 DADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA--------PKETVKEES--GKDEL 839
            + DQ+  W+K YK+GKV PF KS              V  +L+D+VF SGKNVL+EFYAPWCGHCK+LAPILDEVAVS+Q+DADVVIAK DATANDIP DTF+VQGYPT++FRSASGK   Y+G RTKEDI++FIE N+DK          PK   + E+   KDEL
Sbjct:  346 ELDQLPTWLKAYKDGKVEPFVKSEPIPETNNEPVKVVVGQTLEDVVFKSGKNVLIEFYAPWCGHCKQLAPILDEVAVSFQSDADVVIAKLDATANDIPTDTFDVQGYPTLYFRSASGKLSQYDGGRTKEDIIEFIEKNKDKTGAAHQEVEQPKAAAQPEAEQPKDEL 512          

HSP 2 Score: 68.1662 bits (165), Expect = 6.711e-11
Identity = 36/96 (37.50%), Postives = 58/96 (60.42%), Query Frame = -2
Query:  411 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDATA---NDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA 683
            +++EFYAPWCGHCKKLAP  ++ A +   ++  VV+AK DA      D+  +  +V+G+PT+  FR+       Y+G R  E IV++++     A+
Sbjct:   53 IVVEFYAPWCGHCKKLAPEYEKAASILSTHEPPVVLAKVDANEEHNKDLASEN-DVKGFPTIKIFRNGGKNIQEYKGPREAEGIVEYLKKQSGPAS 147          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDI_DATGL (Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 5.615e-50
Identity = 92/155 (59.35%), Postives = 120/155 (77.42%), Query Frame = -2
Query:  375 DADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKD 839
            + D IA WVKEYK+ K+ P+RKS              VADSL ++VF SGKNVLLEFYAPWCGHCK+LAPILDEVAVS++ND DV+IAK DATAND P +TF+V+GYPT++F+SASG+ + Y+G RTKED ++FIE NR+K++ KE++ ++   D
Sbjct:  346 EPDHIASWVKEYKDCKLSPYRKSEPIPEHNNEPVKVVVADSLDEIVFKSGKNVLLEFYAPWCGHCKQLAPILDEVAVSFENDPDVLIAKLDATANDYPTNTFDVKGYPTLYFKSASGELLQYDGGRTKEDFIEFIEKNREKSSKKESIVKDDQTD 500          

HSP 2 Score: 75.485 bits (184), Expect = 4.203e-13
Identity = 41/101 (40.59%), Postives = 60/101 (59.41%), Query Frame = -2
Query:  393 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTVFFRSASGKTV-PYEGDRTKEDIVDFIENNRDKAAPKETVK 683
            +++EFYAPWCGHCKKLAP  ++ A +   +D  V++AK DA   AN      FEV+G+PT+      GK V  Y+G R  + IVD+++  +    P   +K
Sbjct:   53 IVVEFYAPWCGHCKKLAPEYEKAASILSSHDPPVILAKVDANEEANKELASEFEVRGFPTIKILRNGGKIVQEYKGPRDADGIVDYLK--KQSGPPSAEIK 151          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDI1_ARATH (Probable protein disulfide-isomerase 1 OS=Arabidopsis thaliana GN=At1g21750 PE=1 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 7.334e-50
Identity = 95/159 (59.75%), Postives = 116/159 (72.96%), Query Frame = -2
Query:  369 DADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA--PKETVKEESGKDEL 839
            + DQI  WVK++K+GK+ P +KS              V+DSL D+V NSGKNVLLEFYAPWCGHC+KLAPILDEVAVSYQ+D+ VVIAK DATAND P DTF+V+G+PT++F+SASG  V YEGDRTKED + F++ N+D      KE    E  KDEL
Sbjct:  343 EVDQIESWVKDFKDGKIAPHKKSQPIPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDTVGEPKKEEETTEEVKDEL 501          

HSP 2 Score: 69.707 bits (169), Expect = 2.306e-11
Identity = 38/95 (40.00%), Postives = 55/95 (57.89%), Query Frame = -2
Query:  411 VLLEFYAPWCGHCKKLAPILDEVAVSY-QNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA 683
            +++EFYAPWCGHCK+LAP  ++ A +   N   VV+AK DA+   N      +EVQG+PT+  FR+       Y G R  E IV +++     A+
Sbjct:   50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSGPAS 144          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDI2_ARATH (Protein disulfide-isomerase 2 OS=Arabidopsis thaliana GN=At1g77510 PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.171e-47
Identity = 94/169 (55.62%), Postives = 119/169 (70.41%), Query Frame = -2
Query:  369 DADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDK------------AAPKETVKEESGKDEL 839
            + DQI  W K++++GKV   +KS              VA+SL D+VF SGKNVL+EFYAPWCGHC+KLAPILDEVA+S+QND  V+IAK DATANDIP DTF+V+G+PT++FRSASG  V YEGDRTKED ++F+E N +K              PK+T +E + KDEL
Sbjct:  341 EVDQIESWFKDFQDGKVAVHKKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSVIIAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNSEKKPTSHGEESTKSEEPKKT-EETAAKDEL 508          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDI_MAIZE (Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.285e-43
Identity = 89/168 (52.98%), Postives = 113/168 (67.26%), Query Frame = -2
Query:  369 DADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAP-----------KETVKEESGKDEL 839
            +ADQI  W+KEY +GK+ PFR S              VAD++ D VF SGKNVL+EFYAPWCGHCKKLAPILDE A + Q+D +VVIAK DATAND+P + F+VQGYPT++F + SGK   Y+  RT +DIVDFI+ +++ AAP           +E  + E  KDEL
Sbjct:  347 EADQIVAWLKEYFDGKLTPFRNSEPIPEVNNEPVKVVVADNVHDFVFKSGKNVLIEFYAPWCGHCKKLAPILDEAATTLQSDEEVVIAKMDATANDVPSE-FDVQGYPTLYFVTPSGKVTSYDSGRTADDIVDFIKKSKETAAPHHHHHPGATGIREGSRAEPVKDEL 513          

HSP 2 Score: 71.2478 bits (173), Expect = 7.927e-12
Identity = 38/104 (36.54%), Postives = 60/104 (57.69%), Query Frame = -2
Query:  384 VLLEFYAPWCGHCKKLAPILDEVAVSY-QNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEES 683
            +++EFYAPWCGHCKKLAP  +  A +  ++D  +V+AK DA    N      +E+QG+PT+  FR        Y+G R  + IVD+++     A+ +    E++
Sbjct:   54 MVVEFYAPWCGHCKKLAPEYENAAKALSKHDPPIVLAKVDANEEKNRPLATKYEIQGFPTIKIFRDRGKNIQEYKGPREADGIVDYLKKQVGPASKEIKSPEDA 157          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDI_HORVU (Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 6.649e-43
Identity = 83/154 (53.90%), Postives = 109/154 (70.78%), Query Frame = -2
Query:  378 DADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGK 839
            +A QI  W+K+Y +GK+ PFRKS              VAD++ D+VF SGKNVL+EFYAPWCGHCKKLAPILDE A + Q++ DVVIAK DAT ND+PG+ F+VQGYPT++F + SGK V YEG RT ++IVD+I  N++ A       E++ +
Sbjct:  350 EAGQIVAWLKDYFDGKLTPFRKSEPIPEANNEPVKVVVADNVHDVVFKSGKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKMDATENDVPGE-FDVQGYPTLYFVTPSGKKVSYEGGRTADEIVDYIRKNKETAGQAAAATEKAAE 502          

HSP 2 Score: 76.2554 bits (186), Expect = 2.464e-13
Identity = 48/137 (35.04%), Postives = 76/137 (55.47%), Query Frame = -2
Query:  342 ADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIEN-----NRDKAAPKETVKEESGKDEL*EGMGMFRE 725
            AD+  D +      +L+EFYAPWCGHCK LAP  ++ A +  ++D  +V+AK DA    N      +EVQG+PT+  FR+       Y+G R  E IV++++      +++  AP++    E GK  +   +G+F E
Sbjct:   45 ADNFDDAI-GQHPFILVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPAIVLAKVDANDEKNKPLAGKYEVQGFPTLKIFRNGGKSIQEYKGPREAEGIVEYLKKQVGPASKEIKAPEDATYLEDGKIHI---VGVFTE 177          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDI_WHEAT (Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.134e-42
Identity = 83/155 (53.55%), Postives = 108/155 (69.68%), Query Frame = -2
Query:  375 DADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKD 839
            +A QI  W+K+Y +GK+ PFRKS              VAD++ D+VF S KNVL+EFYAPWCGHCKKLAPILDE A + Q++ DVVIAK DATAND+PG+ F+VQGYPT++F + SGK V YEG RT ++IVD+I+ N++ A        E   +
Sbjct:  351 EAGQIVAWLKDYFDGKLTPFRKSEPIPEANNEPVKVVVADNIHDVVFKSAKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKIDATANDVPGE-FDVQGYPTLYFVTPSGKKVSYEGGRTADEIVDYIKKNKETAGQAAAAATEKAAE 504          

HSP 2 Score: 77.0258 bits (188), Expect = 1.445e-13
Identity = 46/123 (37.40%), Postives = 71/123 (57.72%), Query Frame = -2
Query:  342 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIEN-----NRDKAAPKETVKEESGKDEL*EGMGMFRE 683
            +L+EFYAPWCGHCK LAP  ++ A +  ++D  +V+AK DA    N      +EVQG+PT+  FRS       Y+G R  E IV++++      +++  AP++    E GK  +   +G+F E
Sbjct:   59 ILVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPAIVLAKVDANDEKNKPLAGKYEVQGFPTLKIFRSGGKNIQEYKGPREAEGIVEYLKKQVGPASKEIKAPEDATYLEDGKIHI---VGVFTE 178          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDIA4_HUMAN (Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 6.252e-25
Identity = 56/144 (38.89%), Postives = 84/144 (58.33%), Query Frame = -2
Query:  417 DADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYE---GDRTKEDIVDFIENNRDK 839
            D+D +  +V  +K+GK+ P  KS              V  +   +V +  K+VL+EFYAPWCGHCK+L P+ + +A  Y+    +VIAK DATAND+P D ++V+G+PT++F  +  K  P +   GDR  E +  FIE +  K
Sbjct:  494 DSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATK 637          

HSP 2 Score: 82.0333 bits (201), Expect = 4.491e-15
Identity = 39/81 (48.15%), Postives = 53/81 (65.43%), Query Frame = -2
Query:  444 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIV 683
            VLLEFYAPWCGHCK+ AP  +++A +    D  + +AK DAT+  +    F+V GYPT+      G+ V YEG RT+E+IV
Sbjct:   82 VLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILK-KGQAVDYEGSRTQEEIV 161          

HSP 3 Score: 76.6406 bits (187), Expect = 1.887e-13
Identity = 42/94 (44.68%), Postives = 54/94 (57.45%), Query Frame = -2
Query:  435 DMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSY-QNDADVVIAKFDATANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFI 710
            D V N    +L+EFYAPWCGHCKKLAP  ++ A    +    + +AK DATA       F+V GYPT+  FR   G+   Y G R K  IVD++
Sbjct:  188 DEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFR--KGRPYDYNGPREKYGIVDYM 279          
BLAST of CF832020 vs. ExPASy Swiss-Prot
Match: PDI1_SCHPO (Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe GN=SPAC1F5.02 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.819e-24
Identity = 64/152 (42.11%), Postives = 90/152 (59.21%), Query Frame = -2
Query:  387 ADQIAPWVKEYKEGKVPPFRKSXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVP--YEGDRTKEDIVDFIENNRDKAAPKETVKEE 836
            A  +  +V ++ +GK+ P  KS               AD+  D+V +  K+VL+EFYAPWCGHCK LAP  +++A  Y +D++VV+AK DAT NDI   +  + G+PT+ F  A+ K  P  YEGDRT ED+  FI    DK A  E +K+E
Sbjct:  326 AKAMTKFVGDFVDGKLQPKIKSQPIPESQEDLVVLV-ADNFDDIVMDETKDVLVEFYAPWCGHCKNLAPTYEKLAEEYSDDSNVVVAKIDATENDI---SVSISGFPTIMFFKANDKVNPVRYEGDRTLEDLSAFI----DKHASFEPIKKE 469          
The following BLAST results are available for this feature:
BLAST of CF832020 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 70
Match NameE-valueIdentityDescription
PDI_RICCO2.129e-5769.43Protein disulfide-isomerase OS=Ricinus communis PE... [more]
PDI_MEDSA5.615e-5059.88Protein disulfide-isomerase OS=Medicago sativa GN=... [more]
PDI_DATGL5.615e-5059.35Protein disulfide-isomerase OS=Datisca glomerata G... [more]
PDI1_ARATH7.334e-5059.75Probable protein disulfide-isomerase 1 OS=Arabidop... [more]
PDI2_ARATH1.171e-4755.62Protein disulfide-isomerase 2 OS=Arabidopsis thali... [more]
PDI_MAIZE2.285e-4352.98Protein disulfide-isomerase OS=Zea mays GN=PDI PE=... [more]
PDI_HORVU6.649e-4353.90Protein disulfide-isomerase OS=Hordeum vulgare GN=... [more]
PDI_WHEAT1.134e-4253.55Protein disulfide-isomerase OS=Triticum aestivum G... [more]
PDIA4_HUMAN6.252e-2538.89Protein disulfide-isomerase A4 OS=Homo sapiens GN=... [more]
PDI1_SCHPO1.819e-2442.11Putative protein disulfide-isomerase C1F5.02 OS=Sc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01C23_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01C23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832020 ID=CF832020|Name=CF832020|organism=Citrus sinensis|type=EST|length=840bp
TTTTTTTTTTTTTTGGACGTAATAAGCAAAATCCGAAATAATTAACGCAT
TAAATTAAAATTATCCATTACGGATTTAACACGCAGTAAGTTACTCCTAG
GCCGAAAATACTAATATCACAACTATGCGAATACCAAAAAGTACTGCAGC
TACAAATGCCAAAAATGCCTCCCCATTTTATTCACGGGAACAGAACAGAT
CTGTAAAGGGAAATGGCCTCAGAAAAAGCTATAAGGGGGGATATAGGACA
AGGGGGAGGAGAACATCAGGCATTGTTTTGTCGACACTGATAGTTTTGGT
ATAACATCCGCCAAACACGCGCCAACCGACTATGTGCACGGCTCTCTAAA
CATACCCATTCCTTCTTAGAGCTCATCTTTTCCAGATTCCTCTTTTACAG
TTTCCTTGGGGGCAGCTTTGTCCCTGTTATTTTCAATGAAGTCAACAATA
TCTTCTTTGGTCCTATCCCCCTCATAGGGCACTGTCTTTCCACTAGCAGA
TCGGAAGAACACGGTTGGGTAACCTTGGACTTCAAAGGTGTCACCAGGAA
TATCATTTGCGGTTGCATCAAATTTTGCAATAACAACATCAGCATCATTT
TGATATGAGACAGCAACTTCATCCAAGATTGGAGCCAACTTTTTGCAGTG
TCCACACCAAGGAGCGTAAAACTCGAGCAAAACATTTTTTCCAGAGTTGA
AAACCATGTCCTGAAGGCTGTCAGCAACAACCACTTTCACAGGCTCGTTG
TTCTCTTCAGGGATAGGCTCAGACTTTCTGAATGGGGGAACCTTGCCTTC
CTTGTATTCCTTCACCCAAGGTGCAATCTGATCGGCATCC
back to top