CF832021

Overview
NameCF832021
Unique NameCF832021
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length716
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6288 contig Csv1_Contig6288:132..847. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832021 vs. ExPASy Swiss-Prot
Match: PDI_RICCO (Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 1.221e-105
Identity = 185/238 (77.73%), Postives = 211/238 (88.66%), Query Frame = 3
Query:    3 EADRIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKLRSDYEFGHTQNAKLLPRGESSVTGPVVRLLKPFDELFVDFKDFKVDALEKFVEESSIPIVTVFNSDANNHPFVIKFFNSPNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQGISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKS 716
            EAD I EYLKKQSGPAS EIKS E A++FIG+KK+ I+GVFP FSGEE+ENY ++A+KLRSDYEFGHT +AK LP+GESSVTGPVVRL KPFDELFVDFKDF VDALEKFVEESS+P+VTVFNSD +NHPFVIKFFNSP+AKAMLFMNF+ E  + I+SKY+EVA Q+KG+GI  LLGD+EASQGAFQYFGL+E QVPLI+IQTNDGQKYLK NL+ D IAPWVK YKEGKV  +RKS
Sbjct:  130 EADGIAEYLKKQSGPASVEIKSTEAANTFIGDKKIFIVGVFPKFSGEEYENYMSVADKLRSDYEFGHTLDAKHLPQGESSVTGPVVRLFKPFDELFVDFKDFNVDALEKFVEESSMPVVTVFNSDPSNHPFVIKFFNSPDAKAMLFMNFNGEAADSIKSKYQEVAHQFKGEGIILLLGDVEASQGAFQYFGLKEDQVPLIIIQTNDGQKYLKANLEPDHIAPWVKAYKEGKVQAYRKS 367          
BLAST of CF832021 vs. ExPASy Swiss-Prot
Match: PDI_MEDSA (Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 8.187e-102
Identity = 174/238 (73.11%), Postives = 211/238 (88.66%), Query Frame = 3
Query:    3 EADRIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKLRSDYEFGHTQNAKLLPRGESSVTGPVVRLLKPFDELFVDFKDFKVDALEKFVEESSIPIVTVFNSDANNHPFVIKFFNSPNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQGISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKS 716
            EA+ IVEYLKKQSGPAS EIKSA+DA++F+G+ KVVI+GVFP FSGEE++N+ ALAEKLRSDY+F HT NAK LP+G+SSV+GPVVRL KPFDELFVD KDF V+ALEKF+EESS PIVTVFN++ +NHPFV+KFFNSPNAKAMLF+NF++EG E  ++KY EVAEQYK QG+SFL+GD+E+SQGAFQYFGL+E QVPLI+IQ NDG+K+ KPNL+ DQ+  W+K YK+GKV PF KS
Sbjct:  131 EAEGIVEYLKKQSGPASTEIKSADDATAFVGDNKVVIVGVFPKFSGEEYDNFIALAEKLRSDYDFAHTLNAKHLPKGDSSVSGPVVRLFKPFDELFVDSKDFNVEALEKFIEESSTPIVTVFNNEPSNHPFVVKFFNSPNAKAMLFINFTTEGAESFKTKYHEVAEQYKQQGVSFLVGDVESSQGAFQYFGLKEEQVPLIIIQHNDGKKFFKPNLELDQLPTWLKAYKDGKVEPFVKS 368          
BLAST of CF832021 vs. ExPASy Swiss-Prot
Match: PDI_DATGL (Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 6.931e-101
Identity = 175/238 (73.53%), Postives = 209/238 (87.82%), Query Frame = 3
Query:    3 EADRIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKLRSDYEFGHTQNAKLLPRGESSVTGPVVRLLKPFDELFVDFKDFKVDALEKFVEESSIPIVTVFNSDANNHPFVIKFFNSPNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQGISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKS 716
            +AD IV+YLKKQSGP SAEIKS EDA++ + EKK+V++G+FP FSGEEFEN++ALAEKLRSDYEFGHT +AKLLPRGESSV+GPVVRL KPFDELFVDF+DF V+ALEK VEESS+P VT+F+ D +NHPFV+KFFN+ NAKAMLF+NF+SE  E  +S YREVAE+ KG+GISFL+GD E+SQGAFQYFGL++ QVPLIVIQ NDG KYLKPNL+ D IA WVKEYK+ K+ P+RKS
Sbjct:  131 DADGIVDYLKKQSGPPSAEIKSIEDATNLVSEKKIVVVGIFPKFSGEEFENFSALAEKLRSDYEFGHTLDAKLLPRGESSVSGPVVRLFKPFDELFVDFQDFDVNALEKLVEESSVPTVTIFDKDPSNHPFVVKFFNNANAKAMLFLNFTSEVVESFRSIYREVAEKNKGEGISFLIGDTESSQGAFQYFGLRDDQVPLIVIQNNDGTKYLKPNLEPDHIASWVKEYKDCKLSPYRKS 368          
BLAST of CF832021 vs. ExPASy Swiss-Prot
Match: PDI1_ARATH (Probable protein disulfide-isomerase 1 OS=Arabidopsis thaliana GN=At1g21750 PE=1 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 2.820e-94
Identity = 165/238 (69.33%), Postives = 200/238 (84.03%), Query Frame = 3
Query:    3 EADRIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKLRSDYEFGHTQNAKLLPRGESSVTGPVVRLLKPFDELFVDFKDFKVDALEKFVEESSIPIVTVFNSDANNHPFVIKFFNSPNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQGISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKS 716
            EA+ IV YLKKQSGPASAEIKSA+DAS  + +KKVV++G+FP  SG EF+++ A+AEKLRS+ +F HT +AKLLPRGESSVTGPVVRL KPFDE FVD KDF  +ALEKFV+ESSIP++TVF+ D NNHP+VIKFF S N KAMLF+NF+ EG E ++SKYREVA   KGQG+SFLLGD E SQGAFQYFGL+ESQVPLI+IQT D +KYLK N++ DQI  WVK++K+GK+ P +KS
Sbjct:  128 EAEGIVTYLKKQSGPASAEIKSADDASEVVSDKKVVVVGIFPKLSGSEFDSFMAIAEKLRSELDFAHTSDAKLLPRGESSVTGPVVRLFKPFDEQFVDSKDFDGEALEKFVKESSIPLITVFDKDPNNHPYVIKFFESTNTKAMLFINFTGEGAESLKSKYREVATSNKGQGLSFLLGDAENSQGAFQYFGLEESQVPLIIIQTADDKKYLKTNVEVDQIESWVKDFKDGKIAPHKKS 365          
BLAST of CF832021 vs. ExPASy Swiss-Prot
Match: PDI2_ARATH (Protein disulfide-isomerase 2 OS=Arabidopsis thaliana GN=At1g77510 PE=1 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 8.225e-86
Identity = 155/238 (65.13%), Postives = 191/238 (80.25%), Query Frame = 3
Query:    3 EADRIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKLRSDYEFGHTQNAKLLPRGESSVTGPVVRLLKPFDELFVDFKDFKVDALEKFVEESSIPIVTVFNSDANNHPFVIKFFNSPNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQGISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKS 716
            EA+ IV YLKKQSGPAS EIKSA+ A+  +GEK VV +GVFP  SG+EF+++ ALAEKLR+DY+F HT +AK LPRGES V GP VRL KPFDELFVD KDF  +ALEKFV+ESSIP+VTVF+SD NNHP+V KFF SP  KAM+F+NF+    E ++SKYREVA   K Q ++FL+GD E+SQGAFQYFGL+ESQVPLI+IQT D +KYLK N++ DQI  W K++++GKV   +KS
Sbjct:  127 EAEGIVTYLKKQSGPASVEIKSADSATEVVGEKNVVAVGVFPKLSGDEFDSFMALAEKLRADYDFAHTLDAKFLPRGES-VEGPAVRLFKPFDELFVDSKDFNGEALEKFVKESSIPLVTVFDSDPNNHPYVAKFFESPATKAMMFVNFTGATAEALKSKYREVATSNKDQSLAFLVGDAESSQGAFQYFGLEESQVPLIIIQTPDNKKYLKVNVEVDQIESWFKDFQDGKVAVHKKS 363          
BLAST of CF832021 vs. ExPASy Swiss-Prot
Match: PDI_MAIZE (Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 5.344e-77
Identity = 139/238 (58.40%), Postives = 182/238 (76.47%), Query Frame = 3
Query:    3 EADRIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKLRSDYEFGHTQNAKLLPRGESSVTGPVVRLLKPFDELFVDFKDFKVDALEKFVEESSIPIVTVFNSDANNHPFVIKFFNSPNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQGISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKS 716
            EAD IV+YLKKQ GPAS EIKS EDA++ I +KK+ I+G+F  FSG EF N+  +AEKLRSDY+FGHT +A  LPRG+++V  P+VRLLKPFDEL VD KDF V AL KF++ S+IP V  F+ + +NHP+++KFF S   KAMLF+NFS+   +  +S Y   AE++K + I FL+GD+EASQGAFQYFGL+E Q PLI+IQ  D +K+LK +++ADQI  W+KEY +GK+ PFR S
Sbjct:  132 EADGIVDYLKKQVGPASKEIKSPEDATALIDDKKIYIVGIFAEFSGTEFTNFMEVAEKLRSDYDFGHTLHANHLPRGDAAVERPLVRLLKPFDELVVDSKDFDVAALMKFIDASTIPRVVTFDKNPDNHPYLMKFFQSSAPKAMLFLNFSTGPFDSFKSAYSAAAEEFKDKEIKFLIGDIEASQGAFQYFGLKEDQTPLILIQDGDSKKFLKVHVEADQIVAWLKEYFDGKLTPFRNS 369          
BLAST of CF832021 vs. ExPASy Swiss-Prot
Match: PDI_WHEAT (Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 7.985e-73
Identity = 134/238 (56.30%), Postives = 178/238 (74.79%), Query Frame = 3
Query:    3 EADRIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKLRSDYEFGHTQNAKLLPRGESSVTGPVVRLLKPFDELFVDFKDFKVDALEKFVEESSIPIVTVFNSDANNHPFVIKFFNSPNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQGISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKS 716
            EA+ IVEYLKKQ GPAS EIK+ EDA+ ++ + K+ I+GVF  FSG EF N+  LAEKLRSDY+FGHT +A  LPRG+++V  P+VRL KPFDEL VD KDF V ALEKF++ SS P V  F+ + +NHP+++K+F S   KAMLF+NFS+   E  +S Y    E++ G+ + FL+GD+EASQGAFQY GL+E Q PLI+IQ +D +K+LK  ++A QI  W+K+Y +GK+ PFRKS
Sbjct:  137 EAEGIVEYLKKQVGPASKEIKAPEDAT-YLEDGKIHIVGVFTEFSGTEFTNFLELAEKLRSDYDFGHTVHANHLPRGDAAVERPLVRLFKPFDELVVDSKDFDVSALEKFIDASSTPKVVTFDKNPDNHPYLLKYFQSNAPKAMLFLNFSTGPFESFKSAYYGAVEEFSGKDVKFLIGDIEASQGAFQYNGLKEDQAPLILIQDSDSKKFLKEQVEAGQIVAWLKDYFDGKLTPFRKS 373          
BLAST of CF832021 vs. ExPASy Swiss-Prot
Match: PDI_HORVU (Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 2.323e-72
Identity = 133/238 (55.88%), Postives = 178/238 (74.79%), Query Frame = 3
Query:    3 EADRIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKLRSDYEFGHTQNAKLLPRGESSVTGPVVRLLKPFDELFVDFKDFKVDALEKFVEESSIPIVTVFNSDANNHPFVIKFFNSPNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQGISFLLGDLEASQGAFQYFGLQESQVPLIVIQTNDGQKYLKPNLDADQIAPWVKEYKEGKVPPFRKS 716
            EA+ IVEYLKKQ GPAS EIK+ EDA+ ++ + K+ I+GVF  FSG EF N+  +AEKLRS Y+FGHT +A  LPRG+++V  PVVRL KPFDEL VD KDF V ALEKF++ SS P V +F+ + +NHP+++KFF S   KAMLF+NFS+   E  +S Y    E++ G+ + FL+GD+E+SQGAFQYFGL+  Q PLI+IQ  D +K+LK +++A QI  W+K+Y +GK+ PFRKS
Sbjct:  136 EAEGIVEYLKKQVGPASKEIKAPEDAT-YLEDGKIHIVGVFTEFSGPEFTNFLEVAEKLRSYYDFGHTVHANHLPRGDAAVERPVVRLFKPFDELVVDSKDFDVSALEKFIDASSTPKVVIFDKNPDNHPYLLKFFQSNAPKAMLFLNFSTGPFESFKSAYYGAVEEFSGKDVKFLIGDIESSQGAFQYFGLKVDQAPLILIQDGDSKKFLKEHVEAGQIVAWLKDYFDGKLTPFRKS 372          
BLAST of CF832021 vs. ExPASy Swiss-Prot
Match: PDI_DROME (Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.479e-18
Identity = 68/240 (28.33%), Postives = 125/240 (52.08%), Query Frame = 3
Query:    3 EADRIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKLRSDYEFGHTQNAKLLPRGESSVTGPVVRLLKPFDELFVDFK-DFKVDALEKFVEESSIPIVTVFNSDANNHPFVIKFFNSPNAKAMLFMNFSSEG--TEPIQSKYREVAEQYKGQGISFLL-GDLEASQGAFQYFGLQESQVPLI-VIQTNDGQKYLKP---NLDADQIAPWVKEYKEGKV 698
            +A  I+ ++ K++GP + ++ S  DA  F+ + ++ IIG F +   EE + +T +A  L S + FG + NA ++ + E+   G V  L KPFD+    F+ +   + L+KF +  S+P++  F     NH    K F   + K+ L    S EG   E      +E+A++Y+   +   +  D E     F++FG+ + +VP I +I+  +     KP   +L A+ I  ++K++ +GK+
Sbjct:  121 QAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDS-FVFGVSSNADVIAKYEAKDNGVV--LFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDF-----NHESASKIFGG-SIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKL 351          
BLAST of CF832021 vs. ExPASy Swiss-Prot
Match: PDIA3_CHICK (Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.479e-18
Identity = 66/252 (26.19%), Postives = 119/252 (47.22%), Query Frame = 3
Query:    6 ADRIVEYLKKQSGPASAEIKSAEDASSFIGEKKVVIIGVFPNFSGEEFENYTALAEKLRSDYEFGHTQNAKLLPRGESSVTGPVV----RLLKPFDELFVDFKDFKVDA--LEKFVEESSI---PIVTVFNSD-ANNHPFVIKFFNSPNAKAMLFMNFSSEGTEPIQSKYREVAEQYKGQGISFLLGDLEASQGAFQYFGLQES--QVPLIVIQTNDGQKYLKP---NLDADQIAPWVKEYKEGKVPPFRKS 716
            AD IV +LKKQ+GPAS  + S  D   FIG+K   ++G F + SG+ +  +   A  LR +Y F HT   +L+ + E    G V+    RL   F++  V + + K+ +  ++KF++E+     P +T  N D       ++ +++    K     N+       I  K+ +      G  +SF +   +        FGL  S  + P++ I+T  G K++     + D   +  ++++Y +G +  + KS
Sbjct:  119 ADGIVSHLKKQAGPASVALSSVADFEKFIGDKDASVVGFFRDASGDAYSEFMKAANNLRDNYRFAHTSEEQLVQKYEEDGEGVVLYRPSRLANKFEDSTVKYTEDKITSAKIKKFIQENIFGICPHMTEDNKDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMIAKKFLDA-----GHKLSFAVASRKTFGHELSEFGLDNSVGEAPVVAIRTAKGDKFVMQEEFSRDGKALERFLQDYFDGNLKKYLKS 365          
The following BLAST results are available for this feature:
BLAST of CF832021 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
PDI_RICCO1.221e-10577.73Protein disulfide-isomerase OS=Ricinus communis PE... [more]
PDI_MEDSA8.187e-10273.11Protein disulfide-isomerase OS=Medicago sativa GN=... [more]
PDI_DATGL6.931e-10173.53Protein disulfide-isomerase OS=Datisca glomerata G... [more]
PDI1_ARATH2.820e-9469.33Probable protein disulfide-isomerase 1 OS=Arabidop... [more]
PDI2_ARATH8.225e-8665.13Protein disulfide-isomerase 2 OS=Arabidopsis thali... [more]
PDI_MAIZE5.344e-7758.40Protein disulfide-isomerase OS=Zea mays GN=PDI PE=... [more]
PDI_WHEAT7.985e-7356.30Protein disulfide-isomerase OS=Triticum aestivum G... [more]
PDI_HORVU2.323e-7255.88Protein disulfide-isomerase OS=Hordeum vulgare GN=... [more]
PDI_DROME1.479e-1828.33Protein disulfide-isomerase OS=Drosophila melanoga... [more]
PDIA3_CHICK1.479e-1826.19Protein disulfide-isomerase A3 OS=Gallus gallus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01C23_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01C23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832021 ID=CF832021|Name=CF832021|organism=Citrus sinensis|type=EST|length=716bp
GCGAGGCCGATCGTATCGTTGAATATTTGAAGAAACAAAGTGGTCCTGCT
TCTGCTGAAATTAAGTCGGCGGAAGATGCTAGTAGTTTCATCGGTGAGAA
GAAAGTGGTCATTATTGGTGTGTTTCCAAATTTCTCTGGAGAGGAGTTTG
AGAACTACACGGCTCTTGCTGAGAAATTGCGTTCTGATTATGAGTTTGGT
CACACTCAAAATGCCAAGCTCCTTCCACGTGGGGAGTCATCAGTGACTGG
GCCAGTAGTTAGATTGCTCAAGCCTTTTGATGAACTCTTTGTTGACTTTA
AGGACTTTAAAGTGGATGCTCTTGAGAAGTTTGTTGAAGAATCAAGCATT
CCTATAGTGACTGTCTTTAACAGTGATGCAAACAATCACCCATTTGTCAT
CAAATTCTTTAACAGTCCCAATGCAAAGGCTATGTTGTTTATGAACTTCA
GCAGCGAAGGAACTGAACCTATTCAATCAAAGTATCGTGAAGTTGCTGAA
CAATACAAAGGACAGGGCATTAGTTTTCTTTTGGGAGACCTTGAGGCTAG
TCAAGGTGCCTTCCAGTACTTTGGGCTACAAGAGAGCCAAGTACCTCTCA
TCGTCATTCAGACTAATGATGGGCAGAAGTATTTGAAGCCGAACTTGGAT
GCCGATCAGATTGCACCTTGGGTGAAGGAATACAAGGAAGGCAAGGTTCC
CCCATTCAGAAAGTCT
back to top