CF832022

Overview
NameCF832022
Unique NameCF832022
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length837
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6288 contig Csv1_Contig6288:764..1600. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832022 vs. ExPASy Swiss-Prot
Match: PDI_RICCO (Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.474e-58
Identity = 112/162 (69.14%), Postives = 128/162 (79.01%), Query Frame = -1
Query:  352 LKPNLNADQIAPWVKEYKEGKVPPFRKFXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKDEL 837
            LK NL  D IAPWVK YKEGKV  +RK               VAD+LQD+VFNSGKNVLLEFYAPWCGHCK+LAPILDEVAVSY++DAD+VIAK DATANDIP DTF+V+GYPTV+FRSASGK   Y+GDRTK+DI+ FIE NRDKAA +E+    +GKDEL
Sbjct:  340 LKANLEPDHIAPWVKAYKEGKVQAYRKSEPIPEVNNEPVKVVVADTLQDIVFNSGKNVLLEFYAPWCGHCKQLAPILDEVAVSYKSDADIVIAKLDATANDIPSDTFDVRGYPTVYFRSASGKVEQYDGDRTKDDIISFIEKNRDKAAQQESA---NGKDEL 498          

HSP 2 Score: 67.781 bits (164), Expect = 8.764e-11
Identity = 34/95 (35.79%), Postives = 57/95 (60.00%), Query Frame = -1
Query:  394 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTVFFRSASGKTV-PYEGDRTKEDIVDFIENNRDKAA 666
            +++EFYAPWCGHCKKL P  ++ A +   +D  VV+AK DA   AN      ++++G+PT+      GK++  Y+G R  + I ++++     A+
Sbjct:   52 IVVEFYAPWCGHCKKLRPEYEKAASILKSHDIPVVLAKVDANEEANKELATQYDIKGFPTLKILRNGGKSIQEYKGPREADGIAEYLKKQSGPAS 146          
BLAST of CF832022 vs. ExPASy Swiss-Prot
Match: PDI_DATGL (Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 4.594e-52
Identity = 96/160 (60.00%), Postives = 123/160 (76.88%), Query Frame = -1
Query:  358 LKPNLNADQIAPWVKEYKEGKVPPFRKFXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKD 837
            LKPNL  D IA WVKEYK+ K+ P+RK               VADSL ++VF SGKNVLLEFYAPWCGHCK+LAPILDEVAVS++ND DV+IAK DATAND P +TF+V+GYPT++F+SASG+ + Y+G RTKED ++FIE NR+K++ KE++ ++   D
Sbjct:  341 LKPNLEPDHIASWVKEYKDCKLSPYRKSEPIPEHNNEPVKVVVADSLDEIVFKSGKNVLLEFYAPWCGHCKQLAPILDEVAVSFENDPDVLIAKLDATANDYPTNTFDVKGYPTLYFKSASGELLQYDGGRTKEDFIEFIEKNREKSSKKESIVKDDQTD 500          

HSP 2 Score: 75.485 bits (184), Expect = 4.203e-13
Identity = 41/101 (40.59%), Postives = 60/101 (59.41%), Query Frame = -1
Query:  376 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTVFFRSASGKTV-PYEGDRTKEDIVDFIENNRDKAAPKETVK 666
            +++EFYAPWCGHCKKLAP  ++ A +   +D  V++AK DA   AN      FEV+G+PT+      GK V  Y+G R  + IVD+++  +    P   +K
Sbjct:   53 IVVEFYAPWCGHCKKLAPEYEKAASILSSHDPPVILAKVDANEEANKELASEFEVRGFPTIKILRNGGKIVQEYKGPRDADGIVDYLK--KQSGPPSAEIK 151          
BLAST of CF832022 vs. ExPASy Swiss-Prot
Match: PDI_MEDSA (Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.337e-51
Identity = 103/171 (60.23%), Postives = 122/171 (71.35%), Query Frame = -1
Query:  352 KPNLNADQIAPWVKEYKEGKVPPFRKFXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA--------PKETVKEES--GKDEL 834
            KPNL  DQ+  W+K YK+GKV PF K               V  +L+D+VF SGKNVL+EFYAPWCGHCK+LAPILDEVAVS+Q+DADVVIAK DATANDIP DTF+VQGYPT++FRSASGK   Y+G RTKEDI++FIE N+DK          PK   + E+   KDEL
Sbjct:  342 KPNLELDQLPTWLKAYKDGKVEPFVKSEPIPETNNEPVKVVVGQTLEDVVFKSGKNVLIEFYAPWCGHCKQLAPILDEVAVSFQSDADVVIAKLDATANDIPTDTFDVQGYPTLYFRSASGKLSQYDGGRTKEDIIEFIEKNKDKTGAAHQEVEQPKAAAQPEAEQPKDEL 512          

HSP 2 Score: 68.1662 bits (165), Expect = 6.711e-11
Identity = 36/96 (37.50%), Postives = 58/96 (60.42%), Query Frame = -1
Query:  394 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDATA---NDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA 666
            +++EFYAPWCGHCKKLAP  ++ A +   ++  VV+AK DA      D+  +  +V+G+PT+  FR+       Y+G R  E IV++++     A+
Sbjct:   53 IVVEFYAPWCGHCKKLAPEYEKAASILSTHEPPVVLAKVDANEEHNKDLASEN-DVKGFPTIKIFRNGGKNIQEYKGPREAEGIVEYLKKQSGPAS 147          
BLAST of CF832022 vs. ExPASy Swiss-Prot
Match: PDI1_ARATH (Probable protein disulfide-isomerase 1 OS=Arabidopsis thaliana GN=At1g21750 PE=1 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.131e-50
Identity = 97/164 (59.15%), Postives = 118/164 (71.95%), Query Frame = -1
Query:  352 LKPNLNADQIAPWVKEYKEGKVPPFRKFXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA--PKETVKEESGKDEL 837
            LK N+  DQI  WVK++K+GK+ P +K               V+DSL D+V NSGKNVLLEFYAPWCGHC+KLAPILDEVAVSYQ+D+ VVIAK DATAND P DTF+V+G+PT++F+SASG  V YEGDRTKED + F++ N+D      KE    E  KDEL
Sbjct:  338 LKTNVEVDQIESWVKDFKDGKIAPHKKSQPIPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDTVGEPKKEEETTEEVKDEL 501          

HSP 2 Score: 69.707 bits (169), Expect = 2.306e-11
Identity = 38/95 (40.00%), Postives = 55/95 (57.89%), Query Frame = -1
Query:  394 VLLEFYAPWCGHCKKLAPILDEVAVSY-QNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAA 666
            +++EFYAPWCGHCK+LAP  ++ A +   N   VV+AK DA+   N      +EVQG+PT+  FR+       Y G R  E IV +++     A+
Sbjct:   50 IVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSGPAS 144          
BLAST of CF832022 vs. ExPASy Swiss-Prot
Match: PDI2_ARATH (Protein disulfide-isomerase 2 OS=Arabidopsis thaliana GN=At1g77510 PE=1 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.359e-48
Identity = 96/174 (55.17%), Postives = 121/174 (69.54%), Query Frame = -1
Query:  352 LKPNLNADQIAPWVKEYKEGKVPPFRKFXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDK------------AAPKETVKEESGKDEL 837
            LK N+  DQI  W K++++GKV   +K               VA+SL D+VF SGKNVL+EFYAPWCGHC+KLAPILDEVA+S+QND  V+IAK DATANDIP DTF+V+G+PT++FRSASG  V YEGDRTKED ++F+E N +K              PK+T +E + KDEL
Sbjct:  336 LKVNVEVDQIESWFKDFQDGKVAVHKKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVALSFQNDPSVIIAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNSEKKPTSHGEESTKSEEPKKT-EETAAKDEL 508          
BLAST of CF832022 vs. ExPASy Swiss-Prot
Match: PDI_MAIZE (Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.750e-43
Identity = 90/173 (52.02%), Postives = 115/173 (66.47%), Query Frame = -1
Query:  352 LKPNLNADQIAPWVKEYKEGKVPPFRKFXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAP-----------KETVKEESGKDEL 837
            LK ++ ADQI  W+KEY +GK+ PFR                VAD++ D VF SGKNVL+EFYAPWCGHCKKLAPILDE A + Q+D +VVIAK DATAND+P + F+VQGYPT++F + SGK   Y+  RT +DIVDFI+ +++ AAP           +E  + E  KDEL
Sbjct:  342 LKVHVEADQIVAWLKEYFDGKLTPFRNSEPIPEVNNEPVKVVVADNVHDFVFKSGKNVLIEFYAPWCGHCKKLAPILDEAATTLQSDEEVVIAKMDATANDVPSE-FDVQGYPTLYFVTPSGKVTSYDSGRTADDIVDFIKKSKETAAPHHHHHPGATGIREGSRAEPVKDEL 513          

HSP 2 Score: 71.2478 bits (173), Expect = 7.927e-12
Identity = 38/104 (36.54%), Postives = 60/104 (57.69%), Query Frame = -1
Query:  367 VLLEFYAPWCGHCKKLAPILDEVAVSY-QNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEES 666
            +++EFYAPWCGHCKKLAP  +  A +  ++D  +V+AK DA    N      +E+QG+PT+  FR        Y+G R  + IVD+++     A+ +    E++
Sbjct:   54 MVVEFYAPWCGHCKKLAPEYENAAKALSKHDPPIVLAKVDANEEKNRPLATKYEIQGFPTIKIFRDRGKNIQEYKGPREADGIVDYLKKQVGPASKEIKSPEDA 157          
BLAST of CF832022 vs. ExPASy Swiss-Prot
Match: PDI_HORVU (Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2)

HSP 1 Score: 175.252 bits (443), Expect = 3.898e-43
Identity = 84/159 (52.83%), Postives = 111/159 (69.81%), Query Frame = -1
Query:  361 LKPNLNADQIAPWVKEYKEGKVPPFRKFXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGK 837
            LK ++ A QI  W+K+Y +GK+ PFRK               VAD++ D+VF SGKNVL+EFYAPWCGHCKKLAPILDE A + Q++ DVVIAK DAT ND+PG+ F+VQGYPT++F + SGK V YEG RT ++IVD+I  N++ A       E++ +
Sbjct:  345 LKEHVEAGQIVAWLKDYFDGKLTPFRKSEPIPEANNEPVKVVVADNVHDVVFKSGKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKMDATENDVPGE-FDVQGYPTLYFVTPSGKKVSYEGGRTADEIVDYIRKNKETAGQAAAATEKAAE 502          

HSP 2 Score: 76.2554 bits (186), Expect = 2.464e-13
Identity = 48/137 (35.04%), Postives = 76/137 (55.47%), Query Frame = -1
Query:  325 ADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIEN-----NRDKAAPKETVKEESGKDEL*EGMGMFRE 708
            AD+  D +      +L+EFYAPWCGHCK LAP  ++ A +  ++D  +V+AK DA    N      +EVQG+PT+  FR+       Y+G R  E IV++++      +++  AP++    E GK  +   +G+F E
Sbjct:   45 ADNFDDAI-GQHPFILVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPAIVLAKVDANDEKNKPLAGKYEVQGFPTLKIFRNGGKSIQEYKGPREAEGIVEYLKKQVGPASKEIKAPEDATYLEDGKIHI---VGVFTE 177          
BLAST of CF832022 vs. ExPASy Swiss-Prot
Match: PDI_WHEAT (Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 8.684e-43
Identity = 84/160 (52.50%), Postives = 109/160 (68.12%), Query Frame = -1
Query:  358 LKPNLNADQIAPWVKEYKEGKVPPFRKFXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVPYEGDRTKEDIVDFIENNRDKAAPKETVKEESGKD 837
            LK  + A QI  W+K+Y +GK+ PFRK               VAD++ D+VF S KNVL+EFYAPWCGHCKKLAPILDE A + Q++ DVVIAK DATAND+PG+ F+VQGYPT++F + SGK V YEG RT ++IVD+I+ N++ A        E   +
Sbjct:  346 LKEQVEAGQIVAWLKDYFDGKLTPFRKSEPIPEANNEPVKVVVADNIHDVVFKSAKNVLIEFYAPWCGHCKKLAPILDEAAATLQSEEDVVIAKIDATANDVPGE-FDVQGYPTLYFVTPSGKKVSYEGGRTADEIVDYIKKNKETAGQAAAAATEKAAE 504          

HSP 2 Score: 77.0258 bits (188), Expect = 1.445e-13
Identity = 46/123 (37.40%), Postives = 71/123 (57.72%), Query Frame = -1
Query:  325 VLLEFYAPWCGHCKKLAPILDEVA-VSYQNDADVVIAKFDAT--ANDIPGDTFEVQGYPTV-FFRSASGKTVPYEGDRTKEDIVDFIEN-----NRDKAAPKETVKEESGKDEL*EGMGMFRE 666
            +L+EFYAPWCGHCK LAP  ++ A +  ++D  +V+AK DA    N      +EVQG+PT+  FRS       Y+G R  E IV++++      +++  AP++    E GK  +   +G+F E
Sbjct:   59 ILVEFYAPWCGHCKSLAPEYEKAAQLLSKHDPAIVLAKVDANDEKNKPLAGKYEVQGFPTLKIFRSGGKNIQEYKGPREAEGIVEYLKKQVGPASKEIKAPEDATYLEDGKIHI---VGVFTE 178          
BLAST of CF832022 vs. ExPASy Swiss-Prot
Match: PDI1_SCHPO (Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe GN=SPAC1F5.02 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.376e-24
Identity = 65/154 (42.21%), Postives = 91/154 (59.09%), Query Frame = -1
Query:  370 LNADQIAPWVKEYKEGKVPPFRKFXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDADVVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVP--YEGDRTKEDIVDFIENNRDKAAPKETVKEE 825
            L A  +  +V ++ +GK+ P  K               VAD+  D+V +  K+VL+EFYAPWCGHCK LAP  +++A  Y +D++VV+AK DAT NDI   +  + G+PT+ F  A+ K  P  YEGDRT ED+  FI    DK A  E +K+E
Sbjct:  324 LTAKAMTKFVGDFVDGKLQPKIK-SQPIPESQEDLVVLVADNFDDIVMDETKDVLVEFYAPWCGHCKNLAPTYEKLAEEYSDDSNVVVAKIDATENDI---SVSISGFPTIMFFKANDKVNPVRYEGDRTLEDLSAFI----DKHASFEPIKKE 469          
BLAST of CF832022 vs. ExPASy Swiss-Prot
Match: PDI_ASPNG (Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 4.052e-24
Identity = 62/145 (42.76%), Postives = 84/145 (57.93%), Query Frame = -1
Query:  409 LNADQIAPWVKEYKEGKVPPFRKFXXXXXXXXXXXXXXVADSLQDMVFNSGKNVLLEFYAPWCGHCKKLAPILDEVAVSYQNDAD----VVIAKFDATANDIPGDTFEVQGYPTVFFRSASGKTVP--YEGDRTKEDIVDFIENN 825
            LNAD++  ++++  +GKV P  K               VA S +D+V ++ K+VLLEFYAPWCGHCK LAP  DE+A  Y +  D    V IAK DATAND+P     + G+PT+    A  K  P  Y G RT ED+ +F++ N
Sbjct:  327 LNADEVEKFIQDVLDGKVEPSIKSEPVPESQEGPVTVVVAHSYKDLVIDNDKDVLLEFYAPWCGHCKALAPKYDELAALYADHPDLAAKVTIAKIDATANDVPD---PITGFPTLRLYPAGAKDSPIEYSGSRTVEDLANFVKEN 468          
The following BLAST results are available for this feature:
BLAST of CF832022 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 70
Match NameE-valueIdentityDescription
PDI_RICCO1.474e-5869.14Protein disulfide-isomerase OS=Ricinus communis PE... [more]
PDI_DATGL4.594e-5260.00Protein disulfide-isomerase OS=Datisca glomerata G... [more]
PDI_MEDSA1.337e-5160.23Protein disulfide-isomerase OS=Medicago sativa GN=... [more]
PDI1_ARATH1.131e-5059.15Probable protein disulfide-isomerase 1 OS=Arabidop... [more]
PDI2_ARATH2.359e-4855.17Protein disulfide-isomerase 2 OS=Arabidopsis thali... [more]
PDI_MAIZE1.750e-4352.02Protein disulfide-isomerase OS=Zea mays GN=PDI PE=... [more]
PDI_HORVU3.898e-4352.83Protein disulfide-isomerase OS=Hordeum vulgare GN=... [more]
PDI_WHEAT8.684e-4352.50Protein disulfide-isomerase OS=Triticum aestivum G... [more]
PDI1_SCHPO2.376e-2442.21Putative protein disulfide-isomerase C1F5.02 OS=Sc... [more]
PDI_ASPNG4.052e-2442.76Protein disulfide-isomerase OS=Aspergillus niger G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01C24_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01C24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832022 ID=CF832022|Name=CF832022|organism=Citrus sinensis|type=EST|length=837bp
CGTAATAAGCAAAATCCGAAATAATTACCCTATAAAATTAAAATTATCCA
TTACGGATTTAACACGCAGTTTGTTACTCCTAGGCCGAAAATACTAATAT
CACAACTATGCGAATACCAAAAAGTACTGCAGCTACAAATGCCTCCAATG
CCTCCCCATTTTATTCACGGGAACAGAACAGATCTGTAAAGGGAAATGGC
CTCAGAAAAAGCTATAAGGGGGGATATAGGACAAGGGGGAGGAGAACATC
AGGCATTGTTTTGTCGACACTGATAGTTTTGGTATAACATCCGCCAAACA
CGCGCCAACCGACTATGTGCACGGCTCTCTAAACATACCCATTCCTTCTT
AGAGCTCATCTTTTCCAGATTCCTCTTTTACAGTTTCCTTGGGGGCAGCT
TTGTCCCTGTTATTTTCAATGAAGTCAACAATATCTTCTTTGGTCCTATC
CCCCTCATAGGGCACTGTCTTTCCACTAGCAGATCGGAAGAACACGGTTG
GGTAACCTTGGACTTCAAAGGTGTCACCAGGAATATCATTTGCGGTTGCA
TCAAATTTTGCAATAACAACATCAGCATCATTTTGATATGAGACAGCAAC
TTCATCCAAGATTGGAGCCAACTTTTTGCAGTGTCCACACCAAGGAGCGT
AAAACTCGAGCAAAACATTTTTTCCAGAGTTGAAAACCATGTCCTGAAGG
CTGTCAGCAACAACCACTTTCACAGGCTCGTTGTTCTCTTCAGGGATAGG
CTCAAACTTTCTGAATGGGGGAACCTTGCCTTCCTTGTATTCCTTCACCC
AAGGTGCAATCTGATCGGCATTCAAGTTCGGCTTCAA
back to top