CF832024

Overview
NameCF832024
Unique NameCF832024
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length848
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1001 contig Csv1_Contig1001:731..1578. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_BETVU (Elongation factor 2 OS=Beta vulgaris PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 7.077e-85
Identity = 152/168 (90.48%), Postives = 160/168 (95.24%), Query Frame = -1
Query:  345 ALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 848
            ALAEENMRGICFEVCDVVLH DAIHRGGGQ+IPTARRV YASQLTAKPRLLEPVY+VEIQAPE ALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPV+ESFGFS TLRA+TSGQAFPQCVFDHW+MM SDPLE G+QA+ LV+ IRKRKGLKEQMTPLSEFEDKL
Sbjct:  676 ALAEENMRGICFEVCDVVLHTDAIHRGGGQIIPTARRVFYASQLTAKPRLLEPVYLVEIQAPENALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRASTSGQAFPQCVFDHWEMMPSDPLEAGSQASTLVSVIRKRKGLKEQMTPLSEFEDKL 843          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_CHLKE (Elongation factor 2 OS=Chlorella kessleri PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.479e-74
Identity = 133/167 (79.64%), Postives = 151/167 (90.42%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            LAEENMRGI FEVCDVVLHADAIHRGGGQ+IPTARR +YA+QLTA+PRLLEPVY+VEIQ PEQA+GG+YSVLNQKRG VFEE+QRPGTP++N+KAYLPVIESFGF+ TLRAAT+GQAFPQCVFDHW+ M SDP + G+QA  LV DIRKRKGLK +   LSE+EDKL
Sbjct:  679 LAEENMRGIVFEVCDVVLHADAIHRGGGQIIPTARRSMYAAQLTAQPRLLEPVYLVEIQCPEQAMGGVYSVLNQKRGMVFEELQRPGTPIFNLKAYLPVIESFGFTSTLRAATAGQAFPQCVFDHWEAMGSDPTQVGSQANTLVMDIRKRKGLKPEPAALSEYEDKL 845          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_CAEEL (Elongation factor 2 OS=Caenorhabditis elegans GN=eft-2 PE=2 SV=4)

HSP 1 Score: 238.81 bits (608), Expect = 2.893e-62
Identity = 114/167 (68.26%), Postives = 135/167 (80.84%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            L++ENMRG+ F V DV LHADAIHRGGGQ+IPTARRV YAS LTA+PRLLEPVY+VEIQ PE A+GGIY VLN++RGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DPLE GT+  Q+V D RKRKGLKE +  L  + DK+
Sbjct:  686 LSDENMRGVRFNVHDVTLHADAIHRGGGQIIPTARRVFYASVLTAEPRLLEPVYLVEIQCPEAAVGGIYGVLNRRRGHVFEESQVTGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPLEAGTKPNQIVLDTRKRKGLKEGVPALDNYLDKM 852          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_RAT (Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4)

HSP 1 Score: 237.654 bits (605), Expect = 6.446e-62
Identity = 112/168 (66.67%), Postives = 136/168 (80.95%), Query Frame = -1
Query:  345 ALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 848
            AL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  691 ALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_PONAB (Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 SV=3)

HSP 1 Score: 237.654 bits (605), Expect = 6.446e-62
Identity = 112/168 (66.67%), Postives = 136/168 (80.95%), Query Frame = -1
Query:  345 ALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 848
            AL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  691 ALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_MOUSE (Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2)

HSP 1 Score: 237.654 bits (605), Expect = 6.446e-62
Identity = 112/168 (66.67%), Postives = 136/168 (80.95%), Query Frame = -1
Query:  345 ALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 848
            AL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  691 ALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_MESAU (Elongation factor 2 OS=Mesocricetus auratus GN=EEF2 PE=2 SV=3)

HSP 1 Score: 237.654 bits (605), Expect = 6.446e-62
Identity = 112/168 (66.67%), Postives = 136/168 (80.95%), Query Frame = -1
Query:  345 ALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 848
            AL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  691 ALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_HUMAN (Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 SV=4)

HSP 1 Score: 237.654 bits (605), Expect = 6.446e-62
Identity = 112/168 (66.67%), Postives = 136/168 (80.95%), Query Frame = -1
Query:  345 ALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 848
            AL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  691 ALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_CALJA (Elongation factor 2 OS=Callithrix jacchus GN=EEF2 PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.100e-61
Identity = 112/168 (66.67%), Postives = 136/168 (80.95%), Query Frame = -1
Query:  345 ALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 848
            AL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  691 ALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNTSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_BOVIN (Elongation factor 2 OS=Bos taurus GN=EEF2 PE=2 SV=3)

HSP 1 Score: 236.884 bits (603), Expect = 1.100e-61
Identity = 112/168 (66.67%), Postives = 136/168 (80.95%), Query Frame = -1
Query:  345 ALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 848
            AL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  691 ALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEETQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNTSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
The following BLAST results are available for this feature:
BLAST of CF832024 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
EF2_BETVU7.077e-8590.48Elongation factor 2 OS=Beta vulgaris PE=2 SV=1[more]
EF2_CHLKE1.479e-7479.64Elongation factor 2 OS=Chlorella kessleri PE=2 SV=... [more]
EF2_CAEEL2.893e-6268.26Elongation factor 2 OS=Caenorhabditis elegans GN=e... [more]
EF2_RAT6.446e-6266.67Elongation factor 2 OS=Rattus norvegicus GN=Eef2 P... [more]
EF2_PONAB6.446e-6266.67Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 S... [more]
EF2_MOUSE6.446e-6266.67Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 S... [more]
EF2_MESAU6.446e-6266.67Elongation factor 2 OS=Mesocricetus auratus GN=EEF... [more]
EF2_HUMAN6.446e-6266.67Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 S... [more]
EF2_CALJA1.100e-6166.67Elongation factor 2 OS=Callithrix jacchus GN=EEF2 ... [more]
EF2_BOVIN1.100e-6166.67Elongation factor 2 OS=Bos taurus GN=EEF2 PE=2 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01D01_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01D01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832024 ID=CF832024|Name=CF832024|organism=Citrus sinensis|type=EST|length=848bp
TAATAATATATCAACCAACGTCGGCCAGAATTAGTCCTTCACATGACAGA
ACATCAAACCTTAAAAGCTGTGAATTGTAAAATTTAAAACCTAGATGACA
GAGACAGGGTTACTAAACCCAATCAACAGTAATATTACTTTACTAAACAC
AATGAGGATATTGAAAAACTTTGAAACAAAAATAAGCATCAGCAAAAAAT
ATTGCTGCGCAATCTCACCCTTGATGTCAAGATGAAATGTTTACAGCTCG
TCCTCTACTCGGATAGCGGTGTCATTTGCTCCCTCTTCCTGATATCAGCA
ACAAGCTGCGCAATCTCACCCTTGATGTCAAGACGAAATGTTTACAGCTT
GTCCTCAAACTCAGATAGTGGTGTCATTTGCTCCTTCAAGCCCTTCCTCT
TCCTGATATCAGCAACAAGCTGTGCAGCCTGTGTACCAGGCTCCAGTGGA
TCGGATGACATCATGTCCCAGTGATCAAACACACATTGTGGGAAGGCCTG
TCCTGACGTTGCAGCCCTCAAAGTGCCTGAGAATCCAAAGGACTCGATGA
CGGGAAGGTAAGCCTTGATGTTGTAAAGGGGGGTACCAGGTCTCTGCATT
TCCTCGAACACGTGACCACGTTTCTGATTGAGAACACTGTAAATACCACC
AAGGGCCTGCTCGGGAGCCTGTATTTCGACCATGTAGACAGGCTCAAGAA
GCCTGGGCTTGGCTGTGAGCTGGGAAGCATATATGACCCTCCTAGCAGTA
GGAATGACTTGACCACCACCTCTGTGAATGGCATCAGCATGAAGAACAAC
ATCACATACTTCAAAGCAGATACCTCTCATGTTCTCTTCAGCCAGCGC
back to top