CF832028

Overview
NameCF832028
Unique NameCF832028
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length769
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1002 contig Csv1_Contig1002:1..769. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL72_ARATH (60S ribosomal protein L7-2 OS=Arabidopsis thaliana GN=RPL7B PE=1 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 8.539e-79
Identity = 144/168 (85.71%), Postives = 152/168 (90.48%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRMN 769
            FYV+PEAKLLFIIRIRGINA+DPKTKKILQLLRLRQIFNGVFLKVNKAT+NML RVEPYVTYG+PNLKSVKELIYKRGYGKLN QRIALTDN I+EQALG+HGIIC ED IHEILTVGPHFKEANNFLWPF           KRNHYVEGGDAGNRE++INELIRRMN
Sbjct:   75 FYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKLNHQRIALTDNSIVEQALGKHGIICTEDLIHEILTVGPHFKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELIRRMN 242          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL73_ARATH (60S ribosomal protein L7-3 OS=Arabidopsis thaliana GN=RPL7C PE=2 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 1.115e-78
Identity = 142/168 (84.52%), Postives = 153/168 (91.07%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRMN 769
            FYV+PEAKLLFIIRIRGINA+DPKTKKILQLLRLRQIFNGVFLKVNKAT+NML RVEPYVTYGYPNLKSVKELIYKRGYGKLN QRIALTDN I++QALG+HGIIC+ED IHEI+TVGPHFKEANNFLWPF           KRNHYVEGGDAGNRE++INEL+RRMN
Sbjct:   75 FYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKLNHQRIALTDNSIVDQALGKHGIICVEDLIHEIMTVGPHFKEANNFLWPFQLKAPLGGLKKKRNHYVEGGDAGNRENFINELVRRMN 242          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL74_ARATH (60S ribosomal protein L7-4 OS=Arabidopsis thaliana GN=RPL7D PE=2 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 2.747e-77
Identity = 139/168 (82.74%), Postives = 151/168 (89.88%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRMN 769
            FYV+PEAKLLFIIRIRGINA+DPKTKKILQLLRLRQIFNGVFLKVNKAT+NML RVEPYVTYGYPNLKSVKELIYKRG+GKLN QR ALTDN I++Q LG+HGIIC+ED IHEI+TVGPHFKEANNFLWPF           KRNHYVEGGDAGNRE++INEL+RRMN
Sbjct:   77 FYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGFGKLNHQRTALTDNSIVDQGLGKHGIICVEDLIHEIMTVGPHFKEANNFLWPFQLKAPLGGMKKKRNHYVEGGDAGNRENFINELVRRMN 244          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_PONAB (60S ribosomal protein L7 OS=Pongo abelii GN=RPL7 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 7.759e-64
Identity = 118/168 (70.24%), Postives = 135/168 (80.36%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRMN 769
            FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+NK+RIALTDN +I ++LG++GIICMED IHEI TVG  FKEANNFLWPF           K  H+VEGGDAGNRED IN LIRRMN
Sbjct:   80 FYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN 247          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_MACFA (60S ribosomal protein L7 OS=Macaca fascicularis GN=RPL7 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 7.759e-64
Identity = 118/168 (70.24%), Postives = 135/168 (80.36%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRMN 769
            FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+NK+RIALTDN +I ++LG++GIICMED IHEI TVG  FKEANNFLWPF           K  H+VEGGDAGNRED IN LIRRMN
Sbjct:   80 FYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEICTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN 247          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_HUMAN (60S ribosomal protein L7 OS=Homo sapiens GN=RPL7 PE=1 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 7.759e-64
Identity = 118/168 (70.24%), Postives = 135/168 (80.36%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRMN 769
            FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+NK+RIALTDN +I ++LG++GIICMED IHEI TVG  FKEANNFLWPF           K  H+VEGGDAGNRED IN LIRRMN
Sbjct:   81 FYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN 248          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_BOVIN (60S ribosomal protein L7 OS=Bos taurus GN=RPL7 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 7.759e-64
Identity = 118/168 (70.24%), Postives = 135/168 (80.36%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRMN 769
            FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+NK+RIALTDN +I ++LG++GIICMED IHEI TVG  FKEANNFLWPF           K  H+VEGGDAGNRED IN LIRRMN
Sbjct:   81 FYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN 248          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_MOUSE (60S ribosomal protein L7 OS=Mus musculus GN=Rpl7 PE=2 SV=2)

HSP 1 Score: 242.662 bits (618), Expect = 1.729e-63
Identity = 118/168 (70.24%), Postives = 134/168 (79.76%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRMN 769
            FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+NK+RIALTDN +I ++LG+ GIICMED IHEI TVG  FKEANNFLWPF           K  H+VEGGDAGNRED IN LIRRMN
Sbjct:  103 FYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLIARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN 270          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_RAT (60S ribosomal protein L7 OS=Rattus norvegicus GN=Rpl7 PE=1 SV=2)

HSP 1 Score: 241.891 bits (616), Expect = 2.949e-63
Identity = 117/168 (69.64%), Postives = 134/168 (79.76%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRMN 769
            FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+NK+RIALTDN ++ ++LG+ GIICMED IHEI TVG  FKEANNFLWPF           K  H+VEGGDAGNRED IN LIRRMN
Sbjct:   93 FYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLVARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN 260          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_CHICK (60S ribosomal protein L7 OS=Gallus gallus GN=RPL7 PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.049e-60
Identity = 114/168 (67.86%), Postives = 132/168 (78.57%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRMN 769
            +YV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV +LIYKRGYGK+NK+RIALTDN +I + LG+ GIICMED IHEI TVG +FK  NNFLWPF           K  H+VEGGDAGNRED IN LIRRMN
Sbjct:   79 YYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVHDLIYKRGYGKINKKRIALTDNSLIRKRLGKLGIICMEDVIHEIYTVGKNFKVVNNFLWPFKLSSPRGGMKKKTIHFVEGGDAGNREDQINRLIRRMN 246          
The following BLAST results are available for this feature:
BLAST of CF832028 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
RL72_ARATH8.539e-7985.7160S ribosomal protein L7-2 OS=Arabidopsis thaliana... [more]
RL73_ARATH1.115e-7884.5260S ribosomal protein L7-3 OS=Arabidopsis thaliana... [more]
RL74_ARATH2.747e-7782.7460S ribosomal protein L7-4 OS=Arabidopsis thaliana... [more]
RL7_PONAB7.759e-6470.2460S ribosomal protein L7 OS=Pongo abelii GN=RPL7 P... [more]
RL7_MACFA7.759e-6470.2460S ribosomal protein L7 OS=Macaca fascicularis GN... [more]
RL7_HUMAN7.759e-6470.2460S ribosomal protein L7 OS=Homo sapiens GN=RPL7 P... [more]
RL7_BOVIN7.759e-6470.2460S ribosomal protein L7 OS=Bos taurus GN=RPL7 PE=... [more]
RL7_MOUSE1.729e-6370.2460S ribosomal protein L7 OS=Mus musculus GN=Rpl7 P... [more]
RL7_RAT2.949e-6369.6460S ribosomal protein L7 OS=Rattus norvegicus GN=R... [more]
RL7_CHICK1.049e-6067.8660S ribosomal protein L7 OS=Gallus gallus GN=RPL7 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01D03_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01D03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832028 ID=CF832028|Name=CF832028|organism=Citrus sinensis|type=EST|length=769bp
TTTTTTTTTTTTTTTTTAATTAAAAACAGATCCGCCACTTCCTTAAATGA
AACTAAAACACATGAAAACAAAAAATAAAATCCTTAATGATAATCCAGTC
TGAAGCCAAAATAACAACACTGTCACTGTTATAAAAAGTAAGAAAGTTTC
TACTTAACTTCCAGGGAAAAGGCTGGGAATAATAGGAAACACTAAAAGCC
AAAATTTAAGATATTGATCACATCAAAACTTCTTCAAAAGGGGTAGGATA
TTCTGCAAAAGCCTAGTTCATCCTTCTGATGAGCTCATTGATGTAATCTT
CACGGTTTCCTGCATCACCGCCTTCAACATAGTGGTTCCTCTTCTTCTTC
AGGCCACCCAATGGTGCCTTGAGCTTGAAGGGCCATAGGAAGTTGTTTGC
CTCCTTGAAGTGAGGACCAACAGTCAAAATCTCATGGATGAAATCTTCCA
TGCAAATAATTCCATGCTGCCCAAGAGCCTGTTCGATGATAAAATTGTCG
GTCAAAGCAATCCTCTGCTTATTTAATTTGCCGTAACCCCTCTTGTAAAT
CAGTTCTTTGACACTCTTTAAATTGGGGTACCCATATGTTACATAGGGCT
CAACTCTGTGCAGCATATTGAGTGTGGCTTTGTTCACTTTCAAAAAGACA
CCATTAAAAATCTGTCTCAAACGGAGAAGCTGCAAAATTTTCTTGGTCTT
TGGATCAACAGCATTGATACCGCGAATCCTGATAATGAACAAAAGCTTAG
CTTCTGGGTTGACATAAAA
back to top