CF832029

Overview
NameCF832029
Unique NameCF832029
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length742
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF832029_ssr112 microsatellite CF832029_ssr112:112..123. BLAST: Citrus ESTs to Prunus persica proteins V1
CF832029_ssr172 microsatellite CF832029_ssr172:172..183. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig6180 contig Csv1_Contig6180:17..758. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832029 vs. ExPASy Swiss-Prot
Match: RL72_ARATH (60S ribosomal protein L7-2 OS=Arabidopsis thaliana GN=RPL7B PE=1 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 7.469e-85
Identity = 158/211 (74.88%), Postives = 170/211 (80.57%), Query Frame = 2
Query:  110 LKKKKRXXXXXXXXXXXXXXXXXXXXXTRKLIYNRTKQYAKEYDEEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNSIIEQALGQHGIICMEDLIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXXRNHYVE 742
            LKK+KR                      RKLI+ R +QY+KEY E++KELI LKREAKLKGGFYV+PEAKLLFIIRIRGINA+DPKTKKILQLLRLRQIFNGVFLKVNKAT+NML RVEPYVTYG+PNLKSVKELIYKRGYGKLN QRIALTDNSI+EQALG+HGIIC EDLIHEILTVGPHFKEANNFLWPF            RNHYVE
Sbjct:   13 LKKRKREEEWALEKKQNVEAAKKKNAENRKLIFKRAEQYSKEYAEKEKELISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKLNHQRIALTDNSIVEQALGKHGIICTEDLIHEILTVGPHFKEANNFLWPFQLKAPLGGLKKKRNHYVE 223          
BLAST of CF832029 vs. ExPASy Swiss-Prot
Match: RL74_ARATH (60S ribosomal protein L7-4 OS=Arabidopsis thaliana GN=RPL7D PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.274e-84
Identity = 155/211 (73.46%), Postives = 171/211 (81.04%), Query Frame = 2
Query:  110 LKKKKRXXXXXXXXXXXXXXXXXXXXXTRKLIYNRTKQYAKEYDEEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNSIIEQALGQHGIICMEDLIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXXRNHYVE 742
            LKK+KR                      RKLI+NR KQY+KEY E+++ELI+LKREAKLKGGFYV+PEAKLLFIIRIRGINA+DPKTKKILQLLRLRQIFNGVFLKVNKAT+NML RVEPYVTYGYPNLKSVKELIYKRG+GKLN QR ALTDNSI++Q LG+HGIIC+EDLIHEI+TVGPHFKEANNFLWPF            RNHYVE
Sbjct:   15 LKKRKREEEWALAKKQELEAAKKQNAEKRKLIFNRAKQYSKEYQEKERELIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTYGYPNLKSVKELIYKRGFGKLNHQRTALTDNSIVDQGLGKHGIICVEDLIHEIMTVGPHFKEANNFLWPFQLKAPLGGMKKKRNHYVE 225          
BLAST of CF832029 vs. ExPASy Swiss-Prot
Match: RL73_ARATH (60S ribosomal protein L7-3 OS=Arabidopsis thaliana GN=RPL7C PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.664e-84
Identity = 153/183 (83.61%), Postives = 164/183 (89.62%), Query Frame = 2
Query:  194 RKLIYNRTKQYAKEYDEEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNSIIEQALGQHGIICMEDLIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXXRNHYVE 742
            RKLI+ R +QYAKEY E+  ELIRLKREAKLKGGFYV+PEAKLLFIIRIRGINA+DPKTKKILQLLRLRQIFNGVFLKVNKAT+NML RVEPYVTYGYPNLKSVKELIYKRGYGKLN QRIALTDNSI++QALG+HGIIC+EDLIHEI+TVGPHFKEANNFLWPF            RNHYVE
Sbjct:   41 RKLIFKRAEQYAKEYAEKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKLNHQRIALTDNSIVDQALGKHGIICVEDLIHEIMTVGPHFKEANNFLWPFQLKAPLGGLKKKRNHYVE 223          
BLAST of CF832029 vs. ExPASy Swiss-Prot
Match: RL7_PONAB (60S ribosomal protein L7 OS=Pongo abelii GN=RPL7 PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.049e-62
Identity = 116/183 (63.39%), Postives = 139/183 (75.96%), Query Frame = 2
Query:  194 RKLIYNRTKQYAKEYDEEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNSIIEQALGQHGIICMEDLIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXXRNHYVE 742
            RKLIY + K Y KEY +  +  IR+ R A+  G FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+NK+RIALTDN++I ++LG++GIICMEDLIHEI TVG  FKEANNFLWPF              H+VE
Sbjct:   46 RKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVE 228          
BLAST of CF832029 vs. ExPASy Swiss-Prot
Match: RL7_MOUSE (60S ribosomal protein L7 OS=Mus musculus GN=Rpl7 PE=2 SV=2)

HSP 1 Score: 239.965 bits (611), Expect = 1.049e-62
Identity = 117/183 (63.93%), Postives = 138/183 (75.41%), Query Frame = 2
Query:  194 RKLIYNRTKQYAKEYDEEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNSIIEQALGQHGIICMEDLIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXXRNHYVE 742
            RKLIY + K Y KEY +  +  IR+ R A+  G FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+NK+RIALTDNS+I ++LG+ GIICMEDLIHEI TVG  FKEANNFLWPF              H+VE
Sbjct:   69 RKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLIARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVE 251          
BLAST of CF832029 vs. ExPASy Swiss-Prot
Match: RL7_MACFA (60S ribosomal protein L7 OS=Macaca fascicularis GN=RPL7 PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.049e-62
Identity = 116/183 (63.39%), Postives = 139/183 (75.96%), Query Frame = 2
Query:  194 RKLIYNRTKQYAKEYDEEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNSIIEQALGQHGIICMEDLIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXXRNHYVE 742
            RKLIY + K Y KEY +  +  IR+ R A+  G FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+NK+RIALTDN++I ++LG++GIICMEDLIHEI TVG  FKEANNFLWPF              H+VE
Sbjct:   46 RKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEICTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVE 228          
BLAST of CF832029 vs. ExPASy Swiss-Prot
Match: RL7_HUMAN (60S ribosomal protein L7 OS=Homo sapiens GN=RPL7 PE=1 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.049e-62
Identity = 116/183 (63.39%), Postives = 139/183 (75.96%), Query Frame = 2
Query:  194 RKLIYNRTKQYAKEYDEEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNSIIEQALGQHGIICMEDLIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXXRNHYVE 742
            RKLIY + K Y KEY +  +  IR+ R A+  G FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+NK+RIALTDN++I ++LG++GIICMEDLIHEI TVG  FKEANNFLWPF              H+VE
Sbjct:   47 RKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVE 229          
BLAST of CF832029 vs. ExPASy Swiss-Prot
Match: RL7_BOVIN (60S ribosomal protein L7 OS=Bos taurus GN=RPL7 PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.049e-62
Identity = 116/183 (63.39%), Postives = 139/183 (75.96%), Query Frame = 2
Query:  194 RKLIYNRTKQYAKEYDEEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNSIIEQALGQHGIICMEDLIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXXRNHYVE 742
            RKLIY + K Y KEY +  +  IR+ R A+  G FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+NK+RIALTDN++I ++LG++GIICMEDLIHEI TVG  FKEANNFLWPF              H+VE
Sbjct:   47 RKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVE 229          
BLAST of CF832029 vs. ExPASy Swiss-Prot
Match: RL7_RAT (60S ribosomal protein L7 OS=Rattus norvegicus GN=Rpl7 PE=1 SV=2)

HSP 1 Score: 239.195 bits (609), Expect = 1.790e-62
Identity = 116/183 (63.39%), Postives = 138/183 (75.41%), Query Frame = 2
Query:  194 RKLIYNRTKQYAKEYDEEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNSIIEQALGQHGIICMEDLIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXXRNHYVE 742
            RKLIY + K Y KEY +  +  IR+ R A+  G FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +GYPNLKSV ELIYKRGYGK+NK+RIALTDNS++ ++LG+ GIICMEDLIHEI TVG  FKEANNFLWPF              H+VE
Sbjct:   59 RKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLVARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVE 241          
BLAST of CF832029 vs. ExPASy Swiss-Prot
Match: RL7_NEUCR (60S ribosomal protein L7 OS=Neurospora crassa GN=rpl-7 PE=3 SV=2)

HSP 1 Score: 234.187 bits (596), Expect = 5.758e-61
Identity = 112/165 (67.88%), Postives = 138/165 (83.64%), Query Frame = 2
Query:  194 RKLIYNRTKQYAKEYDEEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNSIIEQALGQHGIICMEDLIHEILTVGPHFKEANNFLWPF 688
            R +I+ R + Y KEY + ++E IRL+R AK  G F++  EAKL+F+IRI+GIN + PK +KILQLLRL QI NGVF++V KAT  M+  VEP+V YGYPNLKSVKELIYKRGYGK+NKQR+ALTDNSIIE+ LG++GIICMEDLIHEI TVGP+FK+A+NFLWPF
Sbjct:   46 RAVIFKRAETYVKEYRDVEREKIRLQRAAKQDGSFHIPAEAKLIFLIRIKGINKIPPKPRKILQLLRLLQINNGVFVRVTKATAEMIKIVEPWVAYGYPNLKSVKELIYKRGYGKVNKQRVALTDNSIIEENLGKYGIICMEDLIHEIYTVGPNFKQASNFLWPF 210          
The following BLAST results are available for this feature:
BLAST of CF832029 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
RL72_ARATH7.469e-8574.8860S ribosomal protein L7-2 OS=Arabidopsis thaliana... [more]
RL74_ARATH1.274e-8473.4660S ribosomal protein L7-4 OS=Arabidopsis thaliana... [more]
RL73_ARATH1.664e-8483.6160S ribosomal protein L7-3 OS=Arabidopsis thaliana... [more]
RL7_PONAB1.049e-6263.3960S ribosomal protein L7 OS=Pongo abelii GN=RPL7 P... [more]
RL7_MOUSE1.049e-6263.9360S ribosomal protein L7 OS=Mus musculus GN=Rpl7 P... [more]
RL7_MACFA1.049e-6263.3960S ribosomal protein L7 OS=Macaca fascicularis GN... [more]
RL7_HUMAN1.049e-6263.3960S ribosomal protein L7 OS=Homo sapiens GN=RPL7 P... [more]
RL7_BOVIN1.049e-6263.3960S ribosomal protein L7 OS=Bos taurus GN=RPL7 PE=... [more]
RL7_RAT1.790e-6263.3960S ribosomal protein L7 OS=Rattus norvegicus GN=R... [more]
RL7_NEUCR5.758e-6167.8860S ribosomal protein L7 OS=Neurospora crassa GN=r... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01D03_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01D03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832029 ID=CF832029|Name=CF832029|organism=Citrus sinensis|type=EST|length=742bp
CGCGAAGCCAGACCGCCTCCGTGAAGAAGATAGATCTAAAAGACCTCTAA
GAACAAATTGAACCAAAGAGATGGCTGAAGCAGCAGCTGTTGTGGTACCA
GAGTCAGTGTTGAAGAAGAAGAAGAGAGAGGAGGAATGGGCATTGGCCAA
GAAGCAGGAGCTGGAAGCCGCGAAGAAGAAGAAGGCTGAGACCCGGAAGC
TCATTTACAACAGAACCAAACAGTACGCTAAAGAGTACGATGAAGAGCAA
AAAGAACTCATTCGTTTGAAGCGTGAGGCCAAGCTTAAGGGTGGATTTTA
TGTCAACCCAGAAGCTAAGCTTTTGTTCATTATCAGGATTCGCGGTATCA
ATGCTGTTGATCCAAAGACCAAGAAAATTTTGCAGCTTCTCCGTTTGAGA
CAGATTTTTAATGGTGTCTTTTTGAAAGTGAACAAAGCCACACTCAATAT
GCTGCACAGAGTTGAGCCCTATGTAACATATGGGTACCCCAATTTAAAGA
GTGTCAAAGAACTGATTTACAAGAGGGGTTACGGCAAATTAAATAAGCAG
AGGATTGCTTTGACCGACAATTCTATCATCGAACAGGCTCTTGGGCAGCA
TGGAATTATCTGCATGGAAGATCTCATCCATGAGATTTTGACTGTTGGTC
CTCACTTCAAGGAGGCAAACAACTTCCTATGGCCCTTCAAGCTCAAGGCA
CCATTGGGTGGCCTGAAGAAGAAGAGGAACCACTATGTTGAA
back to top