CF832034

Overview
NameCF832034
Unique NameCF832034
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length772
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5473 contig Csv1_Contig5473:325..1096. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832034 vs. ExPASy Swiss-Prot
Match: 1433_PEA (14-3-3-like protein OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 2.805e-106
Identity = 194/207 (93.72%), Postives = 199/207 (96.14%), Query Frame = -1
Query:  152 AYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPESEQQ 772
            AYKNVIGARRASWRIISSIEQKEESRGNEDHV+ IRDYRSKIE+ELS+ICDGILKLLD+RLIP ASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLT YK+AQDIANAEL PTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAA    EQQ
Sbjct:   54 AYKNVIGARRASWRIISSIEQKEESRGNEDHVAVIRDYRSKIESELSNICDGILKLLDTRLIPSASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTGYKSAQDIANAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAPKADEQQ 260          
BLAST of CF832034 vs. ExPASy Swiss-Prot
Match: 14333_SOLLC (14-3-3 protein 3 OS=Solanum lycopersicum GN=TFT3 PE=2 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 4.050e-105
Identity = 191/205 (93.17%), Postives = 199/205 (97.07%), Query Frame = -1
Query:  158 AYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPESE 772
            AYKNVIGARRASWRIISSIEQKEESRGNE+HV++IR+YRSKIE ELS ICDGILKLLDS+LIP A+SGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIA+AELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE  KPE +
Sbjct:   55 AYKNVIGARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDSKLIPSATSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIASAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPEEK 259          
BLAST of CF832034 vs. ExPASy Swiss-Prot
Match: 1433_OENEH (14-3-3-like protein OS=Oenothera elata subsp. hookeri PE=2 SV=2)

HSP 1 Score: 379.022 bits (972), Expect = 1.539e-104
Identity = 192/206 (93.20%), Postives = 197/206 (95.63%), Query Frame = -1
Query:  155 AYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPESEQ 772
            AYKNVIGARRASWRIISSIEQKEESRGN+DHVSTIRDYRSKIETELS+IC GILKLLDSRLIP A+SGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTL+AYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLA +AFDEAIAELDTL EESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEAA    EQ
Sbjct:   54 AYKNVIGARRASWRIISSIEQKEESRGNDDHVSTIRDYRSKIETELSNICGGILKLLDSRLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLANEAFDEAIAELDTLEEESYKDSTLIMQLLRDNLTLWTSDMQDDGGDEIKEAAPKPDEQ 259          
BLAST of CF832034 vs. ExPASy Swiss-Prot
Match: 14332_ARATH (14-3-3-like protein GF14 omega OS=Arabidopsis thaliana GN=GRF2 PE=1 SV=2)

HSP 1 Score: 378.252 bits (970), Expect = 2.625e-104
Identity = 192/209 (91.87%), Postives = 198/209 (94.74%), Query Frame = -1
Query:  152 AYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAA--KPESEQQ 772
            AYKNVIGARRASWRIISSIEQKEESRGN+DHV+ IR+YRSKIETELS ICDGILKLLDSRLIP A+SGDSKVFYLKMKGDYHRYLAEFKTG ERK+AAE TL AYK+AQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD ADEIKEAA  KP  EQQ
Sbjct:   51 AYKNVIGARRASWRIISSIEQKEESRGNDDHVTAIREYRSKIETELSGICDGILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLAAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAAAPKPTEEQQ 259          
BLAST of CF832034 vs. ExPASy Swiss-Prot
Match: 1433B_TOBAC (14-3-3-like protein B OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 5.848e-104
Identity = 192/207 (92.75%), Postives = 200/207 (96.62%), Query Frame = -1
Query:  152 AYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPESEQQ 772
            AYKNVIGARRASWRIISSIEQKEESRGNEDHV  I++YRSKIE+ELS+ICDGILKLLDS LIP AS+GDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTL+AYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE  K ++EQQ
Sbjct:   50 AYKNVIGARRASWRIISSIEQKEESRGNEDHVKCIQEYRSKIESELSNICDGILKLLDSCLIPSASAGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE-TKTDNEQQ 255          
BLAST of CF832034 vs. ExPASy Swiss-Prot
Match: 1433C_TOBAC (14-3-3-like protein C OS=Nicotiana tabacum PE=1 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 9.975e-104
Identity = 188/203 (92.61%), Postives = 196/203 (96.55%), Query Frame = -1
Query:  164 AYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPE 772
            AYKNVIGARRASWRIISSIEQKEESRGNE+HV++IR+YRSKIE ELS ICDGILKLLD++LIP A+SGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIA  ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE  KP+
Sbjct:   54 AYKNVIGARRASWRIISSIEQKEESRGNEEHVNSIREYRSKIENELSKICDGILKLLDAKLIPSAASGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIATTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEDPKPD 256          
BLAST of CF832034 vs. ExPASy Swiss-Prot
Match: 14332_SOLLC (14-3-3 protein 2 OS=Solanum lycopersicum GN=TFT2 PE=3 SV=2)

HSP 1 Score: 374.785 bits (961), Expect = 2.902e-103
Identity = 190/207 (91.79%), Postives = 198/207 (95.65%), Query Frame = -1
Query:  152 AYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPESEQQ 772
            AYKNVIGARRASWRIISSIEQKEESRGNE+HV  I++YRSKIE+ELS ICDGILKLLDS LIP AS+GDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTL+AYKAAQDIAN ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE  K ++EQQ
Sbjct:   49 AYKNVIGARRASWRIISSIEQKEESRGNEEHVKCIKEYRSKIESELSDICDGILKLLDSNLIPSASNGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKAAQDIANTELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE-TKNDNEQQ 254          
BLAST of CF832034 vs. ExPASy Swiss-Prot
Match: 14331_ARATH (14-3-3-like protein GF14 chi OS=Arabidopsis thaliana GN=GRF1 PE=1 SV=3)

HSP 1 Score: 373.244 bits (957), Expect = 8.444e-103
Identity = 190/211 (90.05%), Postives = 198/211 (93.84%), Query Frame = -1
Query:  152 AYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKE----AAKPESEQQ 772
            AYKNVIGARRASWRIISSIEQKEESRGN+DHVS IRDYRSKIETELS ICDGILKLLD+ L+P A+SGDSKVFYLKMKGDYHRYLAEFK+G ERK+AAE TLTAYKAAQDIAN+ELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDD AD+IKE    AAKP  EQQ
Sbjct:   56 AYKNVIGARRASWRIISSIEQKEESRGNDDHVSLIRDYRSKIETELSDICDGILKLLDTILVPAAASGDSKVFYLKMKGDYHRYLAEFKSGQERKDAAEHTLTAYKAAQDIANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDVADDIKEAAPAAAKPADEQQ 266          
BLAST of CF832034 vs. ExPASy Swiss-Prot
Match: 14334_ARATH (14-3-3-like protein GF14 phi OS=Arabidopsis thaliana GN=GRF4 PE=1 SV=2)

HSP 1 Score: 372.859 bits (956), Expect = 1.103e-102
Identity = 184/207 (88.89%), Postives = 198/207 (95.65%), Query Frame = -1
Query:  152 AYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAKPESEQQ 772
            AYKNVIGARRASWRIISSIEQKEESRGN+DHV+TIRDYRSKIE+ELS ICDGILKLLD+RL+P +++GDSKVFYLKMKGDYHRYLAEFKTG ERK+AAE TLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD+  +EIKEAA P+  ++
Sbjct:   57 AYKNVIGARRASWRIISSIEQKEESRGNDDHVTTIRDYRSKIESELSKICDGILKLLDTRLVPASANGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDESPEEIKEAAAPKPAEE 263          
BLAST of CF832034 vs. ExPASy Swiss-Prot
Match: 14335_SOLTU (14-3-3-like protein 16R OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 1.440e-102
Identity = 187/207 (90.34%), Postives = 202/207 (97.58%), Query Frame = -1
Query:  155 AYKNVIGARRASWRIISSIEQKEESRGNEDHVSTIRDYRSKIETELSSICDGILKLLDSRLIPCASSGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAA-KPESEQ 772
            AYKNVIGARRASWRIISSIEQKEESRGNEDHV++I++YRSKIE+EL+SIC+GILKLLDS+LI  A++GDSKVFYLKMKGDYHRYLAEFKTGAERKEAAE+TL+AYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDG DEIKEAA KP++ +
Sbjct:   52 AYKNVIGARRASWRIISSIEQKEESRGNEDHVASIKEYRSKIESELTSICNGILKLLDSKLIGSAATGDSKVFYLKMKGDYHRYLAEFKTGAERKEAAENTLSAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAAPKPDNNE 258          
The following BLAST results are available for this feature:
BLAST of CF832034 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 143
Match NameE-valueIdentityDescription
1433_PEA2.805e-10693.7214-3-3-like protein OS=Pisum sativum PE=2 SV=1[more]
14333_SOLLC4.050e-10593.1714-3-3 protein 3 OS=Solanum lycopersicum GN=TFT3 P... [more]
1433_OENEH1.539e-10493.2014-3-3-like protein OS=Oenothera elata subsp. hook... [more]
14332_ARATH2.625e-10491.8714-3-3-like protein GF14 omega OS=Arabidopsis thal... [more]
1433B_TOBAC5.848e-10492.7514-3-3-like protein B OS=Nicotiana tabacum PE=2 SV... [more]
1433C_TOBAC9.975e-10492.6114-3-3-like protein C OS=Nicotiana tabacum PE=1 SV... [more]
14332_SOLLC2.902e-10391.7914-3-3 protein 2 OS=Solanum lycopersicum GN=TFT2 P... [more]
14331_ARATH8.444e-10390.0514-3-3-like protein GF14 chi OS=Arabidopsis thalia... [more]
14334_ARATH1.103e-10288.8914-3-3-like protein GF14 phi OS=Arabidopsis thalia... [more]
14335_SOLTU1.440e-10290.3414-3-3-like protein 16R OS=Solanum tuberosum PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01D07_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01D07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832034 ID=CF832034|Name=CF832034|organism=Citrus sinensis|type=EST|length=772bp
TTTTTTTTTTTTTTTAAAAAGAAAACTTAGTACATTCATAATTCCCTTAC
CAAGAGAAGAATGCCTAAATATTCAAAAGCAGGAACACTAGCAACAAACA
TCTTCTCCCTTTAAAAACAGTGGAGAAAGTTCAATCCCATCTGAATTCTC
ACTGTTGTTCGCTTTCAGGCTTGGCCGCTTCTTTAATCTCGTCTGCTCCA
TCATCCTGCATGTCGGAGGTCCACAGAGTGAGGTTGTCACGAAGAAGTTG
CATGATCAAAGTGCTATCCTTGTAGGACTCCTCACCCAGGGTATCCAACT
CAGCAATTGCCTCGTCAAAAGCCTGCTTGGCCAAATTGCAAGCACGATCA
GGAGAGTTCAGGATCTCATAGTAAAACACAGAGAAGTTCAGAGCCAGTCC
TAAACGGATGGGATGAGTCGGAGCCAATTCTGCATTTGCAATATCCTGAG
CGGCTTTATAAGCAGTGAGGGTACTCTCGGCGGCTTCCTTACGCTCGGCT
CCGGTCTTGAACTCAGCCAAGTACCTGTGATAATCTCCCTTCATCTTCAA
ATAGAAAACCTTGGAGTCACCAGAAGAAGCGCAAGGAATGAGGCGGGAGT
CAAGAAGCTTCAAGATGCCGTCGCAGATCGAGGAAAGCTCGGTCTCGATC
TTGGAGCGGTAATCTCGGATCGTGGAGACGTGGTCCTCGTTGCCGCGGCT
CTCCTCTTTCTGTTCGATGGAGGAAATAATGCGCCAGCTGGCACGGCGGG
CGCCGATGACGTTCTTGTAAGC
back to top