CF832035

Overview
NameCF832035
Unique NameCF832035
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length803
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig610 contig Csv1_Contig610:1050..1854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832035 vs. ExPASy Swiss-Prot
Match: SUC1_ARATH (Sucrose transport protein SUC1 OS=Arabidopsis thaliana GN=SUC1 PE=1 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.563e-54
Identity = 109/179 (60.89%), Postives = 132/179 (73.74%), Query Frame = -1
Query:  267 MLNAIVLGFTSLGVEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVKVGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGPFDAVCGGGNMPAFMVGAVAAALSGIVALTLLPSTTADVPPPITEAG 803
            M N+IVLGF SLGVE + + +GG KRLWG+VNF+LA  L  T L+TK AE +R++     G      P   VK GAL++F VLGIP AITFS PFA+ASIFS  S AGQGLSLGVLNLAIV+PQM+VSL  GPFDA+ GGGN+PAF+V A+AAA+SG++ALT+LPS   D P   T  G
Sbjct:  339 MFNSIVLGFMSLGVEWIGRKLGGAKRLWGIVNFILAAGLAMTVLVTKFAEDHRKTAGDLAG------PSASVKAGALSLFAVLGIPLAITFSTPFALASIFSSCSGAGQGLSLGVLNLAIVIPQMIVSLGGGPFDALFGGGNLPAFIVAAIAAAISGVLALTVLPSPPPDAPKATTMGG 511          
BLAST of CF832035 vs. ExPASy Swiss-Prot
Match: SUC2_ARATH (Sucrose transport protein SUC2 OS=Arabidopsis thaliana GN=SUC2 PE=1 SV=2)

HSP 1 Score: 212.616 bits (540), Expect = 2.042e-54
Identity = 109/172 (63.37%), Postives = 135/172 (78.49%), Query Frame = -1
Query:  288 MLNAIVLGFTSLGVEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVKVGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGPFDAVCGGGNMPAFMVGAVAAALSGIVALTLLPSTTADVP 803
            MLNAIVLGF SLGVE + + +GG KRLWG+VNF+LA+ L  T ++TK AE++RR     GGA     PP  V  GAL +F +LGIPQAITFS+PFA+ASIFS  S AGQGLSLGVLNLAIVVPQM++S+  GPFD + GGGN+PAF++GA+AAA+SG++ALT+LPS   D P
Sbjct:  337 MLNAIVLGFMSLGVEWIGRKLGGAKRLWGIVNFILAICLAMTVVVTKQAENHRRD---HGGAK--TGPPGNVTAGALTLFAILGIPQAITFSIPFALASIFSTNSGAGQGLSLGVLNLAIVVPQMVISVGGGPFDELFGGGNIPAFVLGAIAAAVSGVLALTVLPSPPPDAP 503          
BLAST of CF832035 vs. ExPASy Swiss-Prot
Match: SUT_SPIOL (Sucrose transport protein OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.013e-53
Identity = 112/179 (62.57%), Postives = 135/179 (75.42%), Query Frame = -1
Query:  267 MLNAIVLGFTSLGVEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVKVGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGPFDAVCGGGNMPAFMVGAVAAALSGIVALTLLPSTTADVPPPITEAG 803
            M+N++VLG  SL +E LA+++GG KRLWG+VN +LAV L  T L+TK AE  R S    G A    PPP GVK GALAIF VLGIP AITFS+PFA+ASIFS +S +GQGLSLGVLNLAIVVPQM VS+ SGP+DA+ GGGN+PAF+VGAVAA  S +++ TLLPS     PPP  + G
Sbjct:  347 MINSVVLGVMSLSIEGLARMVGGAKRLWGIVNIILAVCLAMTVLVTKSAEHFRDSHHIMGSAVPP-PPPAGVKGGALAIFAVLGIPLAITFSIPFALASIFSASSGSGQGLSLGVLNLAIVVPQMFVSVTSGPWDAMFGGGNLPAFVVGAVAATASAVLSFTLLPS-----PPPEAKIG 519          
BLAST of CF832035 vs. ExPASy Swiss-Prot
Match: SUC5_ARATH (Sucrose transport protein SUC5 OS=Arabidopsis thaliana GN=SUC5 PE=1 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.760e-51
Identity = 101/172 (58.72%), Postives = 127/172 (73.84%), Query Frame = -1
Query:  288 MLNAIVLGFTSLGVEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVKVGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGPFDAVCGGGNMPAFMVGAVAAALSGIVALTLLPSTTADVP 803
            M N+I+LGF SLGVE + + +GG KRLWG VNF+LA+ L  T L+TK AE +R       G      P  G+K G  ++FTVLGIP AIT+S+PFA+ASIFS  S AGQGLSLGVLN+AI +PQM+VS  SGP DA  GGGN+P+F+VGA+AAA+SG++ALT+LPS   D P
Sbjct:  338 MFNSILLGFVSLGVESIGRKMGGAKRLWGCVNFILAIGLAMTVLVTKSAEHHREIAGPLAG------PSSGIKAGVFSLFTVLGIPLAITYSIPFALASIFSTNSGAGQGLSLGVLNIAICIPQMIVSFSSGPLDAQFGGGNLPSFVVGAIAAAVSGVLALTVLPSPPPDAP 503          
BLAST of CF832035 vs. ExPASy Swiss-Prot
Match: SUC8_ARATH (Sucrose transport protein SUC8 OS=Arabidopsis thaliana GN=SUC8 PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.730e-48
Identity = 99/165 (60.00%), Postives = 124/165 (75.15%), Query Frame = -1
Query:  309 MLNAIVLGFTSLGVEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVKVGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGPFDAVCGGGNMPAFMVGAVAAALSGIVALTLLP 803
            MLN+IVLG  SLG+E ++K IGG KRLWG VN +LAV L  T L+TK AE +RR       A  +  P  G++ GAL +F +LGIP AITFS+PFA+ASI S +S AGQGLSLGVLN+AIV+PQM+VS   GP DA+ GGGN+P F+VGA+AAA+S +VA T+LP
Sbjct:  334 MLNSIVLGIVSLGIEGISKKIGGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRRI------AGPMALPTDGIRAGALTLFALLGIPLAITFSIPFALASIISSSSGAGQGLSLGVLNMAIVIPQMIVSFGVGPIDALFGGGNLPRFVVGAIAAAISSVVAFTVLP 492          
BLAST of CF832035 vs. ExPASy Swiss-Prot
Match: SUC6_ARATH (Putative sucrose transport protein SUC6 OS=Arabidopsis thaliana GN=SUC6 PE=5 SV=2)

HSP 1 Score: 188.348 bits (477), Expect = 4.124e-47
Identity = 96/165 (58.18%), Postives = 124/165 (75.15%), Query Frame = -1
Query:  309 MLNAIVLGFTSLGVEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVKVGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGPFDAVCGGGNMPAFMVGAVAAALSGIVALTLLP 803
            MLN+IVLGF SLG+E +++ +GG KRLWG VN +LAV L  T L+TK AE +RR       A  +  P  G++ GAL +F +LGIP AITFS+PFA+ASI S +S AGQGLSLGVLN+ IV+PQM+VS   GP DA+ GGGN+P F+VGA+AAA+S +VA ++LP
Sbjct:  334 MLNSIVLGFMSLGIEGISRKMGGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRRI------AGPMALPTDGIRAGALTLFALLGIPLAITFSIPFALASIISSSSGAGQGLSLGVLNMTIVIPQMVVSFGVGPIDALFGGGNLPGFVVGAIAAAISSVVAFSVLP 492          
BLAST of CF832035 vs. ExPASy Swiss-Prot
Match: SUC7_ARATH (Putative sucrose transport protein SUC7 OS=Arabidopsis thaliana GN=SUC7 PE=5 SV=2)

HSP 1 Score: 183.341 bits (464), Expect = 1.327e-45
Identity = 96/165 (58.18%), Postives = 122/165 (73.94%), Query Frame = -1
Query:  309 MLNAIVLGFTSLGVEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVKVGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGPFDAVCGGGNMPAFMVGAVAAALSGIVALTLLP 803
            MLN+IVLG  SLG+E +++ +GG KRLWG VN +LAV L  T L+TK AE +RR       A  +  P  G++ GAL +F +LGIP AITFS+PFA+ASI S +S AGQ LSLGVLN+AIV+PQM+VS   GP DA+ G GN+P F+VGA+AAA+S IVA T+LP
Sbjct:  333 MLNSIVLGVMSLGIEGISRKMGGAKRLWGAVNIILAVCLAMTVLVTKKAEEHRRI------AGPMALPTDGIRAGALTLFALLGIPLAITFSIPFALASIISSSSGAGQRLSLGVLNMAIVIPQMIVSFGVGPIDALFGDGNLPGFVVGAIAAAVSSIVAFTVLP 491          
BLAST of CF832035 vs. ExPASy Swiss-Prot
Match: SUC9_ARATH (Sucrose transport protein SUC9 OS=Arabidopsis thaliana GN=SUC9 PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.574e-44
Identity = 95/165 (57.58%), Postives = 122/165 (73.94%), Query Frame = -1
Query:  309 MLNAIVLGFTSLGVEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVKVGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGPFDAVCGGGNMPAFMVGAVAAALSGIVALTLLP 803
            MLN+IVLG  SL + V++K IG  KRLWG VN +LAV L  T L+TK AE +R+       A  +  P   ++ GAL++F +LGIP AITFS+PFA+ASI S +S AGQGLSLGVLN+AIV+PQM+VS   GP DA+ GGGN+P F+VGA+AA +S +VALT+LP
Sbjct:  334 MLNSIVLGVMSLVIGVISKKIGA-KRLWGAVNIILAVCLAMTVLVTKKAEEHRKI------AGRMALPTNAIRDGALSLFAILGIPLAITFSIPFALASIISSSSGAGQGLSLGVLNMAIVIPQMIVSFGVGPIDALFGGGNLPGFVVGAIAALISSVVALTVLP 491          
BLAST of CF832035 vs. ExPASy Swiss-Prot
Match: SUT2_ORYSJ (Sucrose transport protein 2 OS=Oryza sativa subsp. japonica GN=SUT2 PE=2 SV=2)

HSP 1 Score: 136.732 bits (343), Expect = 1.424e-31
Identity = 73/165 (44.24%), Postives = 108/165 (65.45%), Query Frame = -1
Query:  309 MLNAIVLGFTSLGVEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVKVGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGPFDAVCGGGNMPAFMVGAVAAALSGIVALTLLP 803
            MLN+++LGFTS+ +E L +   G   +WGV N L+A+  V   +IT +A++     +          PP G+ + +L +FT+LG P AIT+S+P+AMA+        GQGL++G+LNLAIV+PQ++VSL SGP+D + GGGN PAF V A A+ + G+VA+  LP
Sbjct:  334 MLNSVLLGFTSIVLEKLCRK-WGAGLVWGVSNILMALCFVAMLVITYVAKNMDYPPSGV--------PPTGIVIASLVVFTILGAPLAITYSIPYAMAASRVENLGLGQGLAMGILNLAIVIPQVIVSLGSGPWDQLFGGGNAPAFAVAAAASFIGGLVAILGLP 489          
BLAST of CF832035 vs. ExPASy Swiss-Prot
Match: SUT2_ORYSI (Sucrose transport protein 2 OS=Oryza sativa subsp. indica GN=SUT2M PE=2 SV=2)

HSP 1 Score: 136.732 bits (343), Expect = 1.424e-31
Identity = 73/165 (44.24%), Postives = 108/165 (65.45%), Query Frame = -1
Query:  309 MLNAIVLGFTSLGVEVLAKLIGGVKRLWGVVNFLLAVSLVFTFLITKLAESNRRSVTTAGGATHILPPPVGVKVGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGPFDAVCGGGNMPAFMVGAVAAALSGIVALTLLP 803
            MLN+++LGFTS+ +E L +   G   +WGV N L+A+  V   +IT +A++     +          PP G+ + +L +FT+LG P AIT+S+P+AMA+        GQGL++G+LNLAIV+PQ++VSL SGP+D + GGGN PAF V A A+ + G+VA+  LP
Sbjct:  334 MLNSVLLGFTSIVLEKLCRK-WGAGLVWGVSNILMALCFVAMLVITYVAKNMDYPPSGV--------PPTGIVIASLVVFTILGAPLAITYSIPYAMAASRVENLGLGQGLAMGILNLAIVIPQVIVSLGSGPWDQLFGGGNAPAFAVAAAASFIGGLVAILGLP 489          
The following BLAST results are available for this feature:
BLAST of CF832035 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
SUC1_ARATH1.563e-5460.89Sucrose transport protein SUC1 OS=Arabidopsis thal... [more]
SUC2_ARATH2.042e-5463.37Sucrose transport protein SUC2 OS=Arabidopsis thal... [more]
SUT_SPIOL1.013e-5362.57Sucrose transport protein OS=Spinacia oleracea PE=... [more]
SUC5_ARATH2.760e-5158.72Sucrose transport protein SUC5 OS=Arabidopsis thal... [more]
SUC8_ARATH3.730e-4860.00Sucrose transport protein SUC8 OS=Arabidopsis thal... [more]
SUC6_ARATH4.124e-4758.18Putative sucrose transport protein SUC6 OS=Arabido... [more]
SUC7_ARATH1.327e-4558.18Putative sucrose transport protein SUC7 OS=Arabido... [more]
SUC9_ARATH5.574e-4457.58Sucrose transport protein SUC9 OS=Arabidopsis thal... [more]
SUT2_ORYSJ1.424e-3144.24Sucrose transport protein 2 OS=Oryza sativa subsp.... [more]
SUT2_ORYSI1.424e-3144.24Sucrose transport protein 2 OS=Oryza sativa subsp.... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01D08_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832035 ID=CF832035|Name=CF832035|organism=Citrus sinensis|type=EST|length=803bp
TTTTTTTTTTTTTTTACGAACAAACACCTTGTCAATTATTTCACTCACTA
AACAAGTAACAACATACATTTAAACTCCATACACACACAAGCCTTGCAGC
CATGCACCACATTCATTTACTTACCAGCAGAATTATTTTCCCAAAAGTAC
TCAGCGGTTAGGCACATTTCGGATGACTTAAAAAAAAAAGAAAAAAGTCC
GTCCCTTCTTTATGTCCAACAAACTAAGACTAGCTAGTACTTATTAGTTT
GATTTGCGGTTGCAGTTCCCGCTTCAGTTATCGGCGGGGGAACATCCGCG
GTTGTTGATGGGAGCAGGGTGAGTGCAACGATACCACTTAAGGCAGCCGC
AACTGCGCCGACCATAAAGGCCGGCATGTTGCCACCTCCGCAAACGGCAT
CAAAGGGTCCGCTAAGTAAAGACACCAGCATCTGTGGAACAACTATTGCA
AGATTCAAAACACCCAACGAAAGCCCTTGACCAGCAGCAGAAGTTCTAGA
AAATATGGATGCCATAGCAAACGGAACGCTGAAAGTAATAGCTTGAGGAA
TTCCCAACACAGTGAAGATAGCCAAAGCGCCAACTTTCACACCAACCGGC
GGCGGCAAGATATGGGTGGCTCCGCCTGCTGTGGTGACGGACCGGCGGTT
GGACTCGGCCAATTTGGTAATCAAAAAGGTGAAAACCAAAGAAACCGCCA
ACAAGAAATTGACAACGCCCCAGAGCCTCTTGACGCCACCAATCAGCTTC
GCCAAGACCTCCACACCCAGCGACGTGAACCCCAGAACGATAGCGTTAAG
CAT
back to top