CF832036

Overview
NameCF832036
Unique NameCF832036
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length742
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig610 contig Csv1_Contig610:4..745. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832036 vs. ExPASy Swiss-Prot
Match: SUC1_ARATH (Sucrose transport protein SUC1 OS=Arabidopsis thaliana GN=SUC1 PE=1 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 4.346e-85
Identity = 154/226 (68.14%), Postives = 175/226 (77.43%), Query Frame = 3
Query:   66 PTKNQSSIELRRXXXXXXXX-MWKIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHAAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNRRTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCFFLSIALL 740
            PTK+ +++E +          + KI+ VASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGP+SGMIVQPIVGFHSD C+S+FGRRRP                 YAAD G+  GD + + VK RAI IF +GFWILDVANNTLQGPCRA LADL+    +RTR AN+FFSFFMAVGNVLGYAAGSYT+L+ M PFT +KACD+YCANLKTCFFLSI LL
Sbjct:    9 PTKDAAALETQSPEDFDQPSPLRKIISVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPVSGMIVQPIVGFHSDRCRSKFGRRRPFIATGAALVAVAVFLIGYAADFGYKMGDKLEEKVKVRAIGIFALGFWILDVANNTLQGPCRAFLADLAAGDAKRTRVANAFFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLL 234          
BLAST of CF832036 vs. ExPASy Swiss-Prot
Match: SUC2_ARATH (Sucrose transport protein SUC2 OS=Arabidopsis thaliana GN=SUC2 PE=1 SV=2)

HSP 1 Score: 310.842 bits (795), Expect = 4.805e-84
Identity = 150/220 (68.18%), Postives = 173/220 (78.64%), Query Frame = 3
Query:   81 SSIELRRXXXXXXXXMWKIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHAAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNRRTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCFFLSIALL 740
            S++E +         + KI+ V+SIAAGVQFGWALQLSLLTPYVQLLGIPHKW+SLIWLCGPISGM+VQPIVG+HSD C SRFGRRRP                 YAADIGH+ GD +    KTRAI IF +GFWILDVANNTLQGPCRA LADLS  + ++TRTAN+FFSFFMAVGNVLGYAAGSY +LY ++PFT +++CD+YCANLKTCFFLSI LL
Sbjct:   14 SALETQTGELDQPERLRKIISVSSIAAGVQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPIVGYHSDRCTSRFGRRRPFIVAGAGLVTVAVFLIGYAADIGHSMGDQLDKPPKTRAIAIFALGFWILDVANNTLQGPCRAFLADLSAGNAKKTRTANAFFSFFMAVGNVLGYAAGSYRNLYKVVPFTMTESCDLYCANLKTCFFLSITLL 233          
BLAST of CF832036 vs. ExPASy Swiss-Prot
Match: SUC5_ARATH (Sucrose transport protein SUC5 OS=Arabidopsis thaliana GN=SUC5 PE=1 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 4.067e-83
Identity = 146/203 (71.92%), Postives = 166/203 (81.77%), Query Frame = 3
Query:  132 KIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHAAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNRRTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCFFLSIALL 740
            KI+ VASIAAGVQFGWALQLSLLTPY+QLLGIPHKWSS +WLCGPISGMIVQPIVG+HSD C+SRFGRRRP                 +AAD+GH+ GD + + V+TRAIIIF+ GFW LDVANNTLQGPCRA LADL+    ++TR AN+ FSFFMAVGNVLGYAAGSYT+L+ M PFT +KACD+YCANLKTCFFLSI LL
Sbjct:   33 KIISVASIAAGVQFGWALQLSLLTPYIQLLGIPHKWSSYMWLCGPISGMIVQPIVGYHSDRCESRFGRRRPFIAAGVALVAVSVFLIGFAADMGHSFGDKLENKVRTRAIIIFLTGFWFLDVANNTLQGPCRAFLADLAAGDAKKTRVANACFSFFMAVGNVLGYAAGSYTNLHKMFPFTMTKACDIYCANLKTCFFLSITLL 235          
BLAST of CF832036 vs. ExPASy Swiss-Prot
Match: SUC6_ARATH (Putative sucrose transport protein SUC6 OS=Arabidopsis thaliana GN=SUC6 PE=5 SV=2)

HSP 1 Score: 307.375 bits (786), Expect = 5.312e-83
Identity = 143/205 (69.76%), Postives = 165/205 (80.49%), Query Frame = 3
Query:  126 MWKIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHAAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNRRTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCFFLSIALL 740
            M K++ VASIAAG+QFGWALQLSLLTPYVQLLG+PHKWSS IWLCGP+SG++VQP VG+ SD CKSRFGRRRP                 YAAD GH+ GD V + VK RA++IF +GFWILDVANNTLQGPCRA L DL+    ++TRTAN+FFSFFMAVGNVLGYAAGSYT+LY + PFT +KACD+YCANLK+CFFLSI LL
Sbjct:   30 MRKMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPVSGLLVQPSVGYFSDRCKSRFGRRRPFIAMGALLVAVAVVLIGYAADFGHSMGDKVDEPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLL 234          
BLAST of CF832036 vs. ExPASy Swiss-Prot
Match: SUC8_ARATH (Sucrose transport protein SUC8 OS=Arabidopsis thaliana GN=SUC8 PE=1 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.308e-81
Identity = 140/203 (68.97%), Postives = 162/203 (79.80%), Query Frame = 3
Query:  132 KIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHAAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNRRTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCFFLSIALL 740
            K++ VASIAAG+QFGWALQLSLLTPYVQLLG+PHKWSS IWLCGP+SG++VQP VG+ SD C SRFGRRRP                 YAAD GH+ GD +   VK RA++IF +GFWILDVANNTLQGPCRA L DL+    ++TRTAN+FFSFFMAVGNVLGYAAGSYT+LY + PFT +KACD+YCANLK+CFFLSI LL
Sbjct:   32 KMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPVSGLLVQPSVGYFSDRCTSRFGRRRPFIATGALLVAVAVVLIGYAADFGHSMGDKIDKPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLL 234          
BLAST of CF832036 vs. ExPASy Swiss-Prot
Match: SUC7_ARATH (Putative sucrose transport protein SUC7 OS=Arabidopsis thaliana GN=SUC7 PE=5 SV=2)

HSP 1 Score: 300.442 bits (768), Expect = 6.494e-81
Identity = 139/203 (68.47%), Postives = 161/203 (79.31%), Query Frame = 3
Query:  132 KIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHAAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNRRTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCFFLSIALL 740
            K++ VASIAAG+QFGWALQLSLLTPYVQLLG+PHKW S IWLCGP+SG++VQP VG+ SD C SRFGRRRP                 YAAD GH+ GD +   VK RA++IF +GFWILDVANNTLQGPCRA L DL+    ++TRTAN+FFSFFMAVGNVLGYAAGSYT+LY + PFT +KACD+YCANLK+CFFLSI LL
Sbjct:   31 KMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWPSFIWLCGPVSGLLVQPSVGYFSDRCTSRFGRRRPFIATGALLVAVSVVLIGYAADFGHSMGDKIDKPVKMRAVVIFALGFWILDVANNTLQGPCRAFLGDLAAGDAQKTRTANAFFSFFMAVGNVLGYAAGSYTNLYKIFPFTMTKACDIYCANLKSCFFLSITLL 233          
BLAST of CF832036 vs. ExPASy Swiss-Prot
Match: SUC9_ARATH (Sucrose transport protein SUC9 OS=Arabidopsis thaliana GN=SUC9 PE=1 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.728e-79
Identity = 137/203 (67.49%), Postives = 161/203 (79.31%), Query Frame = 3
Query:  132 KIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHAAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNRRTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCFFLSIALL 740
            K++ VASIAAG+QFGWALQLSLLTPYVQLLG+PHKWSS IWLCGPISG++VQP VG+ SD CKSRFGRRRP                 +AAD GH  GD + ++VK RA+  FV+GFWILDVANNTLQGPCRA L DL+    ++TRTAN+ FSFFMAVGNVLGYAAGSYT+L+ + PFT +KACD+YCANLK+CF +SI LL
Sbjct:   32 KMISVASIAAGIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPISGLLVQPTVGYFSDRCKSRFGRRRPFIATGALLVALAVILIGFAADFGHTMGDKLDEAVKIRAVGFFVVGFWILDVANNTLQGPCRAFLGDLAAGDAKKTRTANAIFSFFMAVGNVLGYAAGSYTNLHKIFPFTVTKACDIYCANLKSCFIISITLL 234          
BLAST of CF832036 vs. ExPASy Swiss-Prot
Match: SUT_SPIOL (Sucrose transport protein OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 3.940e-78
Identity = 138/203 (67.98%), Postives = 162/203 (79.80%), Query Frame = 3
Query:  132 KIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHAAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNRRTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCFFLSIALL 740
            K+ +VAS+AAGVQFGWALQLSLLTPYVQLLGIPH W++ IWLCGPISGMIVQP+VG++SD C SRFGRRRP                 +AADIG A+GD   +  K RAI +FV+GFWILDVANNTLQGPCRALLAD++  S  +TR AN+FFSFFMA+GN+ GYAAGSY+ LY + PFTK+ ACDVYCANLK+CFF+SI LL
Sbjct:   37 KLGLVASVAAGVQFGWALQLSLLTPYVQLLGIPHTWAAYIWLCGPISGMIVQPLVGYYSDRCTSRFGRRRPFIAAGAALVAVAVGLIGFAADIGAASGDPTGNVAKPRAIAVFVVGFWILDVANNTLQGPCRALLADMAAGSQTKTRYANAFFSFFMALGNIGGYAAGSYSRLYTVFPFTKTAACDVYCANLKSCFFISITLL 239          
BLAST of CF832036 vs. ExPASy Swiss-Prot
Match: SUC4_ARATH (Sucrose transport protein SUC4 OS=Arabidopsis thaliana GN=SUC4 PE=1 SV=2)

HSP 1 Score: 253.062 bits (645), Expect = 1.189e-66
Identity = 121/202 (59.90%), Postives = 147/202 (72.77%), Query Frame = 3
Query:  135 IVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDTCKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHAAGDSVTDSVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNRRTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCFFLSIALL 740
            ++ VAS+A G+QFGWALQLSLLTPYVQ LGIPH W+S+IWLCGP+SG+ VQP+VG  SD C S++GRRRP                 +AADIG A GD     +K RAI+ FV+GFWILDVANN  QGPCRALLADL+ + NRRTR AN +FS FMAVGNVLGYA GSY   Y +  FTK+ AC+V CANLK+ F++ +  +
Sbjct:   43 LLRVASVACGIQFGWALQLSLLTPYVQELGIPHAWASVIWLCGPLSGLFVQPLVGHSSDRCTSKYGRRRPFIVAGAVAISISVMVIGHAADIGWAFGDR-EGKIKPRAIVAFVLGFWILDVANNMTQGPCRALLADLTENDNRRTRVANGYFSLFMAVGNVLGYATGSYNGWYKIFTFTKTVACNVECANLKSAFYIDVVFI 243          
BLAST of CF832036 vs. ExPASy Swiss-Prot
Match: SUT2_ORYSJ (Sucrose transport protein 2 OS=Oryza sativa subsp. japonica GN=SUT2 PE=2 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 1.408e-59
Identity = 111/207 (53.62%), Postives = 145/207 (70.05%), Query Frame = 3
Query:  132 KIVMVASIAAGVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPISGMIVQPIVGFHSDT---CKSRFGRRRPXXXXXXXXXXXXXXXXXYAADIGHAAGDSVTD-SVKTRAIIIFVIGFWILDVANNTLQGPCRALLADLSGSSNRRTRTANSFFSFFMAVGNVLGYAAGSYTHLYHMLPFTKSKACDVYCANLKTCFFLSIALL 740
            K++  AS+A GVQFGWALQLSLLTPYVQ LGIPH ++SL+WLCGP+SG++VQP+VG  SD      S  GRRRP                 ++AD+G   GDS+T  S +  AII++++GFW+LDV NN  QGPCRA LADL+ +  RRTR AN++FS FMA+GN+LGYA G+Y+  Y + PFT + +C + CANLK+ F L I +L
Sbjct:   26 KLLRAASVACGVQFGWALQLSLLTPYVQELGIPHAFASLVWLCGPLSGLLVQPLVGHLSDRIAPAASPLGRRRPFIAAGAASIAAAVLTVGFSADLGRIFGDSITPGSTRLGAIIVYLVGFWLLDVGNNATQGPCRAFLADLTENDPRRTRIANAYFSLFMALGNILGYATGAYSGWYKIFPFTVTPSCSISCANLKSAFLLDIIIL 232          
The following BLAST results are available for this feature:
BLAST of CF832036 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
SUC1_ARATH4.346e-8568.14Sucrose transport protein SUC1 OS=Arabidopsis thal... [more]
SUC2_ARATH4.805e-8468.18Sucrose transport protein SUC2 OS=Arabidopsis thal... [more]
SUC5_ARATH4.067e-8371.92Sucrose transport protein SUC5 OS=Arabidopsis thal... [more]
SUC6_ARATH5.312e-8369.76Putative sucrose transport protein SUC6 OS=Arabido... [more]
SUC8_ARATH1.308e-8168.97Sucrose transport protein SUC8 OS=Arabidopsis thal... [more]
SUC7_ARATH6.494e-8168.47Putative sucrose transport protein SUC7 OS=Arabido... [more]
SUC9_ARATH2.728e-7967.49Sucrose transport protein SUC9 OS=Arabidopsis thal... [more]
SUT_SPIOL3.940e-7867.98Sucrose transport protein OS=Spinacia oleracea PE=... [more]
SUC4_ARATH1.189e-6659.90Sucrose transport protein SUC4 OS=Arabidopsis thal... [more]
SUT2_ORYSJ1.408e-5953.62Sucrose transport protein 2 OS=Oryza sativa subsp.... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01D08_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832036 ID=CF832036|Name=CF832036|organism=Citrus sinensis|type=EST|length=742bp
TTTTGGTAGCTCTATTTAGTTGGCTGGCCATGGAGAGTACCGAAGCAGGC
GCAGCTGCAGCAGCACCAACAAAGAATCAATCCTCAATTGAGCTACGGCG
GCCACCAACGCCGCCACCGTACCCGATGTGGAAGATCGTAATGGTGGCGT
CCATAGCAGCGGGGGTGCAATTCGGGTGGGCCCTGCAGCTCTCTCTTTTG
ACCCCCTACGTTCAGCTCCTGGGCATCCCTCACAAATGGTCTTCCCTCAT
TTGGCTCTGCGGCCCCATCTCTGGCATGATCGTCCAGCCCATCGTCGGCT
TCCACAGCGACACCTGCAAATCCCGCTTCGGCCGTCGCCGTCCCTTCATT
CTTGCCGGCGCCGTCCTCGTCGCCATCGCTGTGTTTCTCATCGGCTACGC
CGCCGACATAGGCCACGCCGCGGGCGACTCCGTTACCGATTCCGTCAAAA
CCCGCGCCATCATCATCTTCGTCATCGGCTTCTGGATTCTCGACGTCGCG
AATAACACATTACAAGGCCCATGCAGAGCCCTCCTCGCCGATCTCTCCGG
CAGCAGCAACAGGAGAACAAGAACCGCAAACTCGTTTTTCTCATTCTTCA
TGGCCGTCGGTAACGTGCTCGGCTATGCCGCCGGCTCCTACACTCACTTG
TACCACATGCTTCCGTTCACAAAGTCAAAAGCTTGCGACGTTTACTGTGC
AAATTTGAAAACGTGCTTCTTCCTCTCCATAGCTCTGCTAAT
back to top