CF832095
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF832095 vs. ExPASy Swiss-Prot
Match: RL291_ARATH (60S ribosomal protein L29-1 OS=Arabidopsis thaliana GN=RPL29A PE=1 SV=1) HSP 1 Score: 109.768 bits (273), Expect = 5.832e-24 Identity = 49/60 (81.67%), Postives = 55/60 (91.67%), Query Frame = -2 Query: 240 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 419 MAKSKNHTAHNQS KAHKNGIKKP++HRHT T+GMDPKFLRNQRYARKHN + GE+A+ E Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKAGENASAE 60
BLAST of CF832095 vs. ExPASy Swiss-Prot
Match: RL292_ARATH (60S ribosomal protein L29-2 OS=Arabidopsis thaliana GN=RPL29B PE=2 SV=2) HSP 1 Score: 108.997 bits (271), Expect = 9.947e-24 Identity = 49/60 (81.67%), Postives = 54/60 (90.00%), Query Frame = -2 Query: 240 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 419 MAKSKNHTAHNQS KAHKNGIKKP++HRHT T+GMDPKFLRNQRYARKHN + GE+A E Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKSGENAGVE 60
BLAST of CF832095 vs. ExPASy Swiss-Prot
Match: RL29_RAT (60S ribosomal protein L29 OS=Rattus norvegicus GN=Rpl29 PE=1 SV=3) HSP 1 Score: 87.4261 bits (215), Expect = 3.099e-17 Identity = 38/53 (71.70%), Postives = 45/53 (84.91%), Query Frame = -2 Query: 261 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 419 MAKSKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF832095 vs. ExPASy Swiss-Prot
Match: RL29_PIG (60S ribosomal protein L29 OS=Sus scrofa GN=RPL29 PE=2 SV=4) HSP 1 Score: 87.4261 bits (215), Expect = 3.099e-17 Identity = 38/53 (71.70%), Postives = 45/53 (84.91%), Query Frame = -2 Query: 261 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 419 MAKSKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF832095 vs. ExPASy Swiss-Prot
Match: RL29_MOUSE (60S ribosomal protein L29 OS=Mus musculus GN=Rpl29 PE=2 SV=2) HSP 1 Score: 87.4261 bits (215), Expect = 3.099e-17 Identity = 38/53 (71.70%), Postives = 45/53 (84.91%), Query Frame = -2 Query: 261 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 419 MAKSKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF832095 vs. ExPASy Swiss-Prot
Match: RL29_MACFA (60S ribosomal protein L29 OS=Macaca fascicularis GN=RPL29 PE=2 SV=3) HSP 1 Score: 87.4261 bits (215), Expect = 3.099e-17 Identity = 38/53 (71.70%), Postives = 45/53 (84.91%), Query Frame = -2 Query: 261 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 419 MAKSKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF832095 vs. ExPASy Swiss-Prot
Match: RL29_HUMAN (60S ribosomal protein L29 OS=Homo sapiens GN=RPL29 PE=1 SV=2) HSP 1 Score: 87.4261 bits (215), Expect = 3.099e-17 Identity = 38/53 (71.70%), Postives = 45/53 (84.91%), Query Frame = -2 Query: 261 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 419 MAKSKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF832095 vs. ExPASy Swiss-Prot
Match: RL29_BOVIN (60S ribosomal protein L29 OS=Bos taurus GN=RPL29 PE=2 SV=3) HSP 1 Score: 87.4261 bits (215), Expect = 3.099e-17 Identity = 38/53 (71.70%), Postives = 45/53 (84.91%), Query Frame = -2 Query: 261 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 419 MAKSKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF832095 vs. ExPASy Swiss-Prot
Match: RL29_DROME (60S ribosomal protein L29 OS=Drosophila melanogaster GN=RpL29 PE=1 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 4.948e-15 Identity = 39/56 (69.64%), Postives = 43/56 (76.79%), Query Frame = -2 Query: 252 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGES 419 MAKSKNHT HNQ+ KAH+NGIK+P + RH ST GMD KFL NQRYARK N ES Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREES 56
BLAST of CF832095 vs. ExPASy Swiss-Prot
Match: RL29_YEAST (60S ribosomal protein L29 OS=Saccharomyces cerevisiae GN=RPL29 PE=1 SV=3) HSP 1 Score: 74.3294 bits (181), Expect = 2.715e-13 Identity = 32/46 (69.57%), Postives = 40/46 (86.96%), Query Frame = -2 Query: 282 MAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYA 419 MAKSKNHTAHNQ+ KAH+NGIKKPK +++ S KG+DPKF RN ++A Sbjct: 1 MAKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHA 46 The following BLAST results are available for this feature:
BLAST of CF832095 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 11
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF832095 ID=CF832095; Name=CF832095; organism=Citrus sinensis; type=EST; length=462bpback to top |