CF834753

Overview
NameCF834753
Unique NameCF834753
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length495
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8361 contig Csv1_Contig8361:525..1019. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF834753 vs. ExPASy Swiss-Prot
Match: BCHH_RHOCA (Magnesium-chelatase subunit H OS=Rhodobacter capsulatus GN=bchH PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.074e-19
Identity = 41/95 (43.16%), Postives = 64/95 (67.37%), Query Frame = 2
Query:    8 GPLGVREIEKRLTNTVGWSATSGQVDNWVYEEANTTFIQDEEMLNRLMNTNPSSFRKLVQTFLEANGRGYWETSEENIEKLRQLYSEVEDKIEGI 292
            G  GVR+IE ++TNT+GWSAT+GQV+ WVY+  + TF+ D+EM  RL + N ++  ++ Q  LEA+ R YW+     +  L+    E+ED++EG+
Sbjct: 1097 GAEGVRQIEAQVTNTLGWSATTGQVEPWVYQRLSETFVLDDEMRERLASLNSAASSRMAQRLLEASDRNYWQPDPATLAALQAAADELEDRMEGV 1191          
BLAST of CF834753 vs. ExPASy Swiss-Prot
Match: BCHH_RHOS4 (Magnesium-chelatase subunit H OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=bchH PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 5.244e-19
Identity = 42/95 (44.21%), Postives = 62/95 (65.26%), Query Frame = 2
Query:    8 GPLGVREIEKRLTNTVGWSATSGQVDNWVYEEANTTFIQDEEMLNRLMNTNPSSFRKLVQTFLEANGRGYWETSEENIEKLRQLYSEVEDKIEGI 292
            G  GVR+IE ++TNT+GWSAT+ QV+ WVY+  + TF+ DE M  RL   NP +  ++ +  LEA+ R YW+   E +  L+    E+ED++EGI
Sbjct: 1096 GAEGVRQIEAQVTNTLGWSATTQQVEPWVYQRLSETFVLDEAMRRRLAELNPEASVRMAERLLEASARNYWQPDAETLAALQGAADELEDRLEGI 1190          
BLAST of CF834753 vs. ExPASy Swiss-Prot
Match: BCHH_CHLP8 (Magnesium-chelatase subunit H OS=Chlorobaculum parvum (strain NCIB 8327) GN=bchH PE=3 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 1.292e-17
Identity = 38/95 (40.00%), Postives = 61/95 (64.21%), Query Frame = 2
Query:    8 GPLGVREIEKRLTNTVGWSATSGQVDNWVYEEANTTFIQDEEMLNRLMNTNPSSFRKLVQTFLEANGRGYWETSEENIEKLRQLYSEVEDKIEGI 292
            G  G  EI  R+T  +GW A +  VD+WVY++   T+  D EM  RL   NP + + +V   LEA+GRG W+  +  IE+L+++Y+++ED++EG+
Sbjct: 1174 GHSGAGEISNRVTYMLGWDAVTKSVDDWVYKKTAETYALDPEMRERLATLNPQAIKNIVGRMLEAHGRGMWKADQSMIEELQEIYADLEDRLEGM 1268          
BLAST of CF834753 vs. ExPASy Swiss-Prot
Match: Y1441_METJA (Uncharacterized protein MJ1441 OS=Methanocaldococcus jannaschii GN=MJ1441 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.977e-14
Identity = 36/93 (38.71%), Postives = 57/93 (61.29%), Query Frame = 2
Query:    8 GPLGVREIEKRLTNTVGWSATSGQVDNWVYEEANTTFIQDEEMLNRLMNTNPSSFRKLVQTFLEANGRGYWETSEENIEKLRQLYSEVEDKIE 286
            G  G  +I KR+    GWSAT+ +V+NW+++E   TF+++EE        N  +  ++ +  LEA  RG W+T+E NIE+L++ Y E+E  IE
Sbjct: 1102 GYKGAGDIAKRIGRVYGWSATTKEVENWIFDEIFNTFVKNEENRKFFKEHNIYALEEIARRLLEAYQRGLWKTTEGNIEELKRAYLEIEGDIE 1194          
BLAST of CF834753 vs. ExPASy Swiss-Prot
Match: Y908_METJA (Uncharacterized protein MJ0908 OS=Methanocaldococcus jannaschii GN=MJ0908 PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.059e-11
Identity = 33/93 (35.48%), Postives = 50/93 (53.76%), Query Frame = 2
Query:    8 GPLGVREIEKRLTNTVGWSATSGQVDNWVYEEANTTFIQDEEMLNRLMNTNPSSFRKLVQTFLEANGRGYWETSEENIEKLRQLYSEVEDKIE 286
            G  G  +  K + +   W ATSG +D+W+YE+    ++ D++M       NP +   + +  LEA  RG W+  EE  EKLR+ Y E+E  IE
Sbjct: 1137 GYKGAADFSKYVDHMFAWDATSGIIDDWMYEKIAEKYVFDKDMEEFFKENNPYALLNITERLLEAIERGMWKADEEMKEKLRKKYLEIEGMIE 1229          
The following BLAST results are available for this feature:
BLAST of CF834753 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
BCHH_RHOCA3.074e-1943.16Magnesium-chelatase subunit H OS=Rhodobacter capsu... [more]
BCHH_RHOS45.244e-1944.21Magnesium-chelatase subunit H OS=Rhodobacter sphae... [more]
BCHH_CHLP81.292e-1740.00Magnesium-chelatase subunit H OS=Chlorobaculum par... [more]
Y1441_METJA2.977e-1438.71Uncharacterized protein MJ1441 OS=Methanocaldococc... [more]
Y908_METJA1.059e-1135.48Uncharacterized protein MJ0908 OS=Methanocaldococc... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06B01_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06B01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF834753 ID=CF834753|Name=CF834753|organism=Citrus sinensis|type=EST|length=495bp
GTCCAGTGGTCCTTTGGGTGTTCGTGAAATTGAGAAGCGGCTTACTAACA
CCGTTGGGTGGAGTGCAACTTCGGGCCAAGTTGACAACTGGGTCTACGAA
GAAGCTAACACTACCTTTATCCAAGATGAGGAAATGTTGAACAGGCTGAT
GAATACCAATCCGAGTTCATTTAGGAAGTTGGTGCAAACATTCCTGGAGG
CCAATGGCCGTGGATACTGGGAAACTTCGGAGGAAAACATTGAGAAGTTG
AGGCAGTTGTATTCGGAAGTTGAAGACAAGATTGAAGGGATTGACCGGTG
AATTATAGTAGTAAACTGTTAAAATAGGTCCTAGTCTGCAAATATCAATT
GACAGTGCTGATTTACATAAGCCTTTCTTTTGTCGGGTTCACTGTGAAAT
TATTGGATGCAAGTTCTAGGAACATTTGGGATGTGCATTTGTTCATAAGA
ATGAGGACGGAATTTAATCTTGTTTTTATAAAAAAAAAAAAAAAA
back to top