CF835279

Overview
NameCF835279
Unique NameCF835279
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length677
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1097 contig Csv1_Contig1097:1..677. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835279 vs. ExPASy Swiss-Prot
Match: Y2881_DICDI (Uncharacterized protein DDB_G0288155 OS=Dictyostelium discoideum GN=DDB_G0288155 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.423e-44
Identity = 87/180 (48.33%), Postives = 122/180 (67.78%), Query Frame = 2
Query:  137 VGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPAVDKDAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIPSGEVWGGNPAKFLR 676
            +G  ++ TG  L R GC++QG+Y + E+L+RH  L    D AP V + +F+AP+ASIIGDV +G+ SSIWY  VLRGDVNSI +G  T + D ++VH + +   G   PT IGD V +G  +++H  T+  E+F+G G+TL DG VVE++G + AGSL+     I SGE WGG+PAKF+R
Sbjct:   10 LGEVVKNTGLILHRTGCKMQGDYAYVEKLNRHTRLTAFGDNAPIVGQKSFIAPNASIIGDVVIGKESSIWYNAVLRGDVNSIHIGDKTVVSDRTVVHCSSNGPLGP-KPTQIGDKVYIGPGSIVHAATILGESFIGTGSTLCDGSVVEKNGFLEAGSLLTAGKTIKSGEYWGGSPAKFIR 188          
BLAST of CF835279 vs. ExPASy Swiss-Prot
Match: UMP7_ARATH (Uncharacterized protein At5g63510, mitochondrial OS=Arabidopsis thaliana GN=At5g63510 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.606e-30
Identity = 65/138 (47.10%), Postives = 91/138 (65.94%), Query Frame = 2
Query:  263 PAVDKDAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIPSGEVWGGNPAKFLR 676
            P V  DA+VAP+  + G V V  GSS+W G VLRGD+N I+VG  +N+Q+  +VH A S+ +G    T I   VTVG  ++L  CT+E E  +G  + L++G +VE   ++ AGS+V    RIPSGE+WGGNPA+F+R
Sbjct:   66 PKVAVDAYVAPNVVLAGQVTVWDGSSVWNGAVLRGDLNKITVGFCSNVQERCVVHAAWSSPTGLPAATIIDRYVTVGAYSLLRSCTIEPECIIGQHSILMEGSLVETRSILEAGSVVPPGRRIPSGELWGGNPARFIR 203          
BLAST of CF835279 vs. ExPASy Swiss-Prot
Match: UMP8_ARATH (Uncharacterized protein At3g48680, mitochondrial OS=Arabidopsis thaliana GN=At3g48680 PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 5.806e-30
Identity = 64/138 (46.38%), Postives = 91/138 (65.94%), Query Frame = 2
Query:  263 PAVDKDAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIPSGEVWGGNPAKFLR 676
            P V  DA+VAP+  + G V V  GSS+W G VLRGD+N I+VG  +N+Q+  +VH A S+ +G    T I   VTVG  ++L  CT+E E  +G  + L++G +VE   ++ AGS++    RIPSGE+WGGNPA+F+R
Sbjct:   70 PKVAVDAYVAPNVVLAGQVTVWDGSSVWNGAVLRGDLNKITVGFCSNVQERCVVHAAWSSPTGLPAQTLIDRYVTVGAYSLLRSCTIEPECIIGQHSILMEGSLVETRSILEAGSVLPPGRRIPSGELWGGNPARFIR 207          
BLAST of CF835279 vs. ExPASy Swiss-Prot
Match: YRDA_SHIFL (Protein yrdA OS=Shigella flexneri GN=yrdA PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.095e-28
Identity = 64/142 (45.07%), Postives = 93/142 (65.49%), Query Frame = 2
Query:  254 DKAPAVDKDAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVA-KSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIPSGEVWGGNPAKFLR 676
            D  P + +   +  S+ +IGDV++     IW   V+RGDV+ + +G+ TNIQD S++HV  KS+ +    P TIG++VTVGH  +LHGCT+ +   VGMG+ LLDG +VE   M+ AGSLV QN R+ SG ++ G+P K +R
Sbjct:   10 DLFPQIGQRVMIDDSSVVIGDVRLADDVGIWPLVVIRGDVHYVQIGARTNIQDGSMLHVTHKSSYNPDGNPLTIGEDVTVGHKVMLHGCTIGNRVLVGMGSILLDGAIVEDDVMIGAGSLVPQNKRLESGYLYLGSPVKQIR 151          
BLAST of CF835279 vs. ExPASy Swiss-Prot
Match: YRDA_ECOLI (Protein yrdA OS=Escherichia coli (strain K12) GN=yrdA PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.095e-28
Identity = 64/142 (45.07%), Postives = 93/142 (65.49%), Query Frame = 2
Query:  254 DKAPAVDKDAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVA-KSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIPSGEVWGGNPAKFLR 676
            D  P + +   +  S+ +IGDV++     IW   V+RGDV+ + +G+ TNIQD S++HV  KS+ +    P TIG++VTVGH  +LHGCT+ +   VGMG+ LLDG +VE   M+ AGSLV QN R+ SG ++ G+P K +R
Sbjct:   10 DLFPQIGQRVMIDDSSVVIGDVRLADDVGIWPLVVIRGDVHYVQIGARTNIQDGSMLHVTHKSSYNPDGNPLTIGEDVTVGHKVMLHGCTIGNRVLVGMGSILLDGAIVEDDVMIGAGSLVPQNKRLESGYLYLGSPVKQIR 151          
BLAST of CF835279 vs. ExPASy Swiss-Prot
Match: Y304_METJA (Uncharacterized protein MJ0304 OS=Methanocaldococcus jannaschii GN=MJ0304 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.748e-26
Identity = 58/136 (42.65%), Postives = 85/136 (62.50%), Query Frame = 2
Query:  269 VDKDAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIPSGEVWGGNPAKFLR 676
            + K+  +A  A I+GDV +G  SS+WY  V+RGDV+ I +G+ +NIQD  +VH +K        PT IGD V++GH AV+HGC +ED   VGM AT+L+G  +  + ++ A +LV QN  IP   +  G P + +R
Sbjct:    2 ISKNVRIAKGAVIVGDVTIGDYSSVWYNAVIRGDVDKIIIGNYSNIQDCCVVHCSKG------YPTIIGDYVSIGHGAVIHGCRIEDNVLVGMNATILNGAKIGENCIIGANALVTQNKEIPPNSLVLGVPGRVVR 131          
BLAST of CF835279 vs. ExPASy Swiss-Prot
Match: Y3753_PSEAE (Uncharacterized protein PA3753 OS=Pseudomonas aeruginosa GN=PA3753 PE=3 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 1.480e-25
Identity = 53/133 (39.85%), Postives = 87/133 (65.41%), Query Frame = 2
Query:  278 DAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIPSGEVWGGNPAKFLR 676
            D+++APSA++IG V++  G+S+W+G VLRGD   I +G  +N+QD S++H           P T+G  VTVGH+A+LHGC+V D + VG+ A +L+G  + ++ ++ A +L+ +   IP G +  G+P K +R
Sbjct:   15 DSWIAPSAAVIGKVRLDAGASVWFGAVLRGDNELIHIGEHSNVQDGSVMHTDMG------YPLTLGKGVTVGHNAMLHGCSVGDYSLVGINAVILNGAKIGKYCIIGANALIPEGKEIPDGSLVMGSPGKVVR 141          
BLAST of CF835279 vs. ExPASy Swiss-Prot
Match: YTOA_BACSU (Uncharacterized transferase ytoA OS=Bacillus subtilis GN=ytoA PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.296e-21
Identity = 53/138 (38.41%), Postives = 75/138 (54.35%), Query Frame = 2
Query:  263 PAVDKDAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIPSGEVWGGNPAKFLR 676
            P +   AF+A +A+I GDV +G  SSIW+  V+RGDV    +G+  NIQD S +H + +          I D+ T+GH   LH   +   A +GMG+ +LDG  +     + AGSLV     IP G +  G PAK +R
Sbjct:   10 PDIHPTAFIADNATITGDVVIGEQSSIWFSVVIRGDVAPTRIGNRVNIQDLSCLHQSPNKT------LLIEDDATIGHQVTLHSAVIRKNALIGMGSIILDGAEIGEGAFIGAGSLVPPGKIIPPGHLAFGRPAKVIR 141          
BLAST of CF835279 vs. ExPASy Swiss-Prot
Match: PAAY_ECOLI (Phenylacetic acid degradation protein paaY OS=Escherichia coli (strain K12) GN=paaY PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.693e-21
Identity = 52/138 (37.68%), Postives = 80/138 (57.97%), Query Frame = 2
Query:  263 PAVDKDAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIPSGEVWGGNPAKFLR 676
            P V +++FV P+A +IGDV +G+G  +     LRGD   I V  G NIQDN ++H            T +G++  +GHSA+LHGC +   A VGM A ++DG V+  + +V A + V+    +P+  +  G+PAK +R
Sbjct:   11 PVVPEESFVHPTAVLIGDVILGKGVYVGPNASLRGDFGRIVVKDGANIQDNCVMHGFPEQ------DTVVGEDGHIGHSAILHGCIIRRNALVGMNAVVMDGAVIGENSIVGASAFVKAKAEMPANYLIVGSPAKAIR 142          
BLAST of CF835279 vs. ExPASy Swiss-Prot
Match: CAIE_ECOUT (Carnitine operon protein caiE OS=Escherichia coli (strain UTI89 / UPEC) GN=caiE PE=3 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 4.611e-19
Identity = 54/138 (39.13%), Postives = 75/138 (54.35%), Query Frame = 2
Query:  263 PAVDKDAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIPSGEVWGGNPAKFLR 676
            P V   AFV PSA +IGDV VG G  I     LRGD   + V +G NIQD  ++H            T +G+N  +GH A+LHGC +  +A VGM + ++DG V+    +VAA S V+   R    ++  G PA+ +R
Sbjct:   11 PVVHPTAFVHPSAVLIGDVIVGAGVYIGPLASLRGDYGRLIVQAGANIQDGCIMHGYCDT------DTIVGENGHIGHGAILHGCVIGRDALVGMNSVIMDGAVIGEESIVAAMSFVKAGFRGEKRQLLMGTPARAVR 142          
The following BLAST results are available for this feature:
BLAST of CF835279 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 51
Match NameE-valueIdentityDescription
Y2881_DICDI1.423e-4448.33Uncharacterized protein DDB_G0288155 OS=Dictyostel... [more]
UMP7_ARATH2.606e-3047.10Uncharacterized protein At5g63510, mitochondrial O... [more]
UMP8_ARATH5.806e-3046.38Uncharacterized protein At3g48680, mitochondrial O... [more]
YRDA_SHIFL1.095e-2845.07Protein yrdA OS=Shigella flexneri GN=yrdA PE=3 SV=... [more]
YRDA_ECOLI1.095e-2845.07Protein yrdA OS=Escherichia coli (strain K12) GN=y... [more]
Y304_METJA1.748e-2642.65Uncharacterized protein MJ0304 OS=Methanocaldococc... [more]
Y3753_PSEAE1.480e-2539.85Uncharacterized protein PA3753 OS=Pseudomonas aeru... [more]
YTOA_BACSU1.296e-2138.41Uncharacterized transferase ytoA OS=Bacillus subti... [more]
PAAY_ECOLI1.693e-2137.68Phenylacetic acid degradation protein paaY OS=Esch... [more]
CAIE_ECOUT4.611e-1939.13Carnitine operon protein caiE OS=Escherichia coli ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06P09_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06P09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835279 ID=CF835279|Name=CF835279|organism=Citrus sinensis|type=EST|length=677bp
CTCTCACACAACACACCTTCGCTCAACTTAAGAAACCCAAAACCTCACTG
AACTTGAGCTCCAAAAGTATCGACACTCAGTCACCGATCCCCAAAGCCAA
CAAGAGATGGGAACCCTAGGGCGAGCAGTTTACACCGTTGGCTTCTGGAT
TCGCGAAACCGGTCAGGCCCTTGATCGCCTCGGCTGCCGTCTCCAAGGCA
ACTACTACTTCCAAGAGCAACTGTCTAGGCATCGAACTCTCATGAACATA
TTTGATAAAGCTCCCGCAGTCGACAAGGATGCATTTGTTGCTCCAAGTGC
CTCTATCATTGGTGATGTTCAAGTGGGAAGAGGGTCATCTATTTGGTATG
GATGTGTTTTGAGAGGGGATGTGAATAGCATCAGTGTTGGATCAGGAACA
AATATACAGGACAACTCCCTTGTGCATGTTGCGAAGTCTAATCTAAGTGG
GAAGGTGCTACCGACTACTATTGGGGACAATGTTACTGTAGGCCATAGTG
CTGTTTTACATGGCTGTACTGTTGAGGACGAGGCCTTTGTTGGCATGGGA
GCAACACTACTTGATGGTGTTGTTGTTGAGAGACATGGCATGGTTGCTGC
TGGATCTCTTGTGAGGCAGAATACCAGGATCCCTTCTGGAGAGGTATGGG
GAGGCAATCCAGCAAAGTTCCTGAGAA
back to top