CF835287

Overview
NameCF835287
Unique NameCF835287
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length510
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF835287 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 6.609e-20
Identity = 49/106 (46.23%), Postives = 70/106 (66.04%), Query Frame = -2
Query:  153 IVRESTDLNLRFSVLLSGRD-CCNEQPLWKVDHPDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGR-SFEDGVRRLVL 464
            +VR STD+N+ F  +   RD  C+   +W++D+ D ++GKW++TT G+ G PG  TL +WFK+EK G     YK   CPSVC+SC  LC+++GR S +DG  RL L
Sbjct:   97 VVRVSTDVNIEFVPI---RDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVL--GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLAL 197          
BLAST of CF835287 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 1.800e-17
Identity = 45/105 (42.86%), Postives = 66/105 (62.86%), Query Frame = -2
Query:  153 IVRESTDLNLRFSVLLSGRDCCNEQPLWKVDHPDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFED-GVRRLVL 464
            +VR STDLN+ FS  +  R       +W++D  D ++G++F+T GG+ G+PG ET+ +WFK+E+     G YK+V CP+VC SC   C +VG   +  G RRL L
Sbjct:  104 VVRVSTDLNINFSAFMPCR--WTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCG-SGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLAL 205          
BLAST of CF835287 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 6.625e-12
Identity = 46/121 (38.02%), Postives = 65/121 (53.72%), Query Frame = -2
Query:  153 NGIKLTLSPYNN--STIVRESTDLNLRFSVLLSGRDCCNEQPLWKVDHPDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFED-GVRRLVL 506
            NG  +  S   N    IV ES DLN++F++ ++    CNE   WKVD      G W +T GG  G+ G E+  + FK++K G  P +YK   CPS   + +  CNNV   F+   +RRL+L
Sbjct:   56 NGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN----CNETTAWKVDRFPGVIG-WTVTLGGEKGYHGFESTHSMFKIKKAG-LPFSYKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLIL 170          
The following BLAST results are available for this feature:
BLAST of CF835287 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ASP_THECC6.609e-2046.2321 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU1.800e-1742.86Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA6.625e-1238.02Latex serine proteinase inhibitor OS=Carica papaya... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06P13_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06P13, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835287 ID=CF835287|Name=CF835287|organism=Citrus sinensis|type=EST|length=510bp
TAAANGAGCAGNCTAGGCCTGGCTCCTCGTTATTTAGAACACATAATACC
GNCTAGCCTGGTTAGGGGTACACTTGATTACACAGAGCGTTGATCTTTTC
TGTAGCGGNGAATTAACACAACAGCGAAATTACGGNCTCATCATCACGAA
CCGAGAACCAGACGTCGAACGCCATCCTCAAACGAACGGCCAACGTTGTT
GCAGAGTTTGACACAAGACTCGCAAACGGATGGACAATGAACGATTTTGT
ATGTACCTGGAAAATTTCCAATTTTCTCAAGCTTAAACCAATTTAGCAAA
GTTTCAGCTCCAGGGTGGCCATCAAGTCCCCCGGTTGTTATAAACCATTT
GCCTGATGCAGCGTCGGGGTGATCAACTTTCCACAATGGTTGTTCGTTAC
AACAGTCACGTCCAGATAGCAACACTGAGAATCTCAAGTTGAGATCAGTG
GATTCTCGGACAATTGTAGAATTGTTATACGGTGACAGTGTTAATTTGAT
TCCATTTTGC
back to top