CF835306

Overview
NameCF835306
Unique NameCF835306
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length686
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9834 contig Csv1_Contig9834:136..821. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF835306 vs. ExPASy Swiss-Prot
Match: CALM_SPIOL (Calmodulin OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 1.271e-64
Identity = 122/125 (97.60%), Postives = 124/125 (99.20%), Query Frame = 2
Query:   17 EGCITTKELGTVLRSLGQNPTEAELQDMINEVDADGTGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            +GCITTKELGTV+RSLGQNPTEAELQDMINEVDADG GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   25 DGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CF835306 vs. ExPASy Swiss-Prot
Match: CALM_MEDSA (Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 1.271e-64
Identity = 122/125 (97.60%), Postives = 124/125 (99.20%), Query Frame = 2
Query:   17 EGCITTKELGTVLRSLGQNPTEAELQDMINEVDADGTGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            +GCITTKELGTV+RSLGQNPTEAELQDMINEVDADG GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   25 DGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CF835306 vs. ExPASy Swiss-Prot
Match: CALM_LILLO (Calmodulin OS=Lilium longiflorum PE=2 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 1.271e-64
Identity = 122/125 (97.60%), Postives = 124/125 (99.20%), Query Frame = 2
Query:   17 EGCITTKELGTVLRSLGQNPTEAELQDMINEVDADGTGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            +GCITTKELGTV+RSLGQNPTEAELQDMINEVDADG GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   25 DGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  161 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    1 MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
BLAST of CF835306 vs. ExPASy Swiss-Prot
Match: CALM_HORVU (Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 1.271e-64
Identity = 122/125 (97.60%), Postives = 124/125 (99.20%), Query Frame = 2
Query:   17 EGCITTKELGTVLRSLGQNPTEAELQDMINEVDADGTGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            +GCITTKELGTV+RSLGQNPTEAELQDMINEVDADG GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   25 DGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.3958 bits (163), Expect = 8.094e-11
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  161 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    1 MADQLTD-DQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
BLAST of CF835306 vs. ExPASy Swiss-Prot
Match: CALM_HELAN (Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3)

HSP 1 Score: 246.128 bits (627), Expect = 1.271e-64
Identity = 122/125 (97.60%), Postives = 124/125 (99.20%), Query Frame = 2
Query:   17 EGCITTKELGTVLRSLGQNPTEAELQDMINEVDADGTGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            +GCITTKELGTV+RSLGQNPTEAELQDMINEVDADG GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   25 DGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CF835306 vs. ExPASy Swiss-Prot
Match: CALM_EUPCH (Calmodulin OS=Euphorbia characias PE=2 SV=4)

HSP 1 Score: 246.128 bits (627), Expect = 1.271e-64
Identity = 122/125 (97.60%), Postives = 124/125 (99.20%), Query Frame = 2
Query:   17 EGCITTKELGTVLRSLGQNPTEAELQDMINEVDADGTGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            +GCITTKELGTV+RSLGQNPTEAELQDMINEVDADG GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   25 DGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  161 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    1 MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
BLAST of CF835306 vs. ExPASy Swiss-Prot
Match: CALM_BRYDI (Calmodulin OS=Bryonia dioica PE=2 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 1.271e-64
Identity = 122/125 (97.60%), Postives = 124/125 (99.20%), Query Frame = 2
Query:   17 EGCITTKELGTVLRSLGQNPTEAELQDMINEVDADGTGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            +GCITTKELGTV+RSLGQNPTEAELQDMINEVDADG GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   25 DGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  161 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    1 MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
BLAST of CF835306 vs. ExPASy Swiss-Prot
Match: CALM7_ARATH (Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 1.271e-64
Identity = 122/125 (97.60%), Postives = 124/125 (99.20%), Query Frame = 2
Query:   17 EGCITTKELGTVLRSLGQNPTEAELQDMINEVDADGTGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            +GCITTKELGTV+RSLGQNPTEAELQDMINEVDADG GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   25 DGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  161 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    1 MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
BLAST of CF835306 vs. ExPASy Swiss-Prot
Match: CALM2_SOYBN (Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 1.271e-64
Identity = 122/125 (97.60%), Postives = 124/125 (99.20%), Query Frame = 2
Query:   17 EGCITTKELGTVLRSLGQNPTEAELQDMINEVDADGTGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            +GCITTKELGTV+RSLGQNPTEAELQDMINEVDADG GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   25 DGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.3958 bits (163), Expect = 8.094e-11
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  161 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    1 MADQLTD-DQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
BLAST of CF835306 vs. ExPASy Swiss-Prot
Match: CALM1_PETHY (Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=2 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 1.271e-64
Identity = 122/125 (97.60%), Postives = 124/125 (99.20%), Query Frame = 2
Query:   17 EGCITTKELGTVLRSLGQNPTEAELQDMINEVDADGTGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            +GCITTKELGTV+RSLGQNPTEAELQDMINEVDADG GTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   25 DGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.781 bits (164), Expect = 6.198e-11
Identity = 35/77 (45.45%), Postives = 50/77 (64.94%), Query Frame = 2
Query:  161 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 391
            MA ++ D D   E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    1 MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
The following BLAST results are available for this feature:
BLAST of CF835306 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 420
Match NameE-valueIdentityDescription
CALM_SPIOL1.271e-6497.60Calmodulin OS=Spinacia oleracea PE=1 SV=2[more]
CALM_MEDSA1.271e-6497.60Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2[more]
CALM_LILLO1.271e-6497.60Calmodulin OS=Lilium longiflorum PE=2 SV=2[more]
CALM_HORVU1.271e-6497.60Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2[more]
CALM_HELAN1.271e-6497.60Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3[more]
CALM_EUPCH1.271e-6497.60Calmodulin OS=Euphorbia characias PE=2 SV=4[more]
CALM_BRYDI1.271e-6497.60Calmodulin OS=Bryonia dioica PE=2 SV=2[more]
CALM7_ARATH1.271e-6497.60Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 ... [more]
CALM2_SOYBN1.271e-6497.60Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2[more]
CALM1_PETHY1.271e-6497.60Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=2 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_06P23_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa06P23, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF835306 ID=CF835306|Name=CF835306|organism=Citrus sinensis|type=EST|length=686bp
GTTCTATAGGCCTTTAGAAGGTTGCATTACCACCAAGGAGCTTGGCACTG
TCCTGAGGTCACTGGGTCAGAACCCCACTGAGGCTGAGCTCCAGGACATG
ATCAATGAAGTGGATGCTGATGGTACTGGAACTATTGATTTTCCTGAATT
CCTAAACCTCATGGCCAGGAAGATGAAGGATACCGACTCTGAGGAGGAGC
TGAAAGAGGCCTTCCGGGTTTTCGACAAGGATCAGAATGGTTTCATCTCA
GCTGCTGAGCTGCGCCATGTGATGACAAACCTAGGGGAGAAGCTTACTGA
TGAGGAAGTCGATGAGATGATAAGGGAAGCTGATGTCGATGGTGATGGCC
AGATAAATTACGAGGAATTTGTCAAGGTTATGATGGCTAAGTAAGTGACT
CCACCCAACCAAAACTTCCTGGGAAAAGAAGAAATTGGTTGATTAATATA
ATTGGTTCCCTAGTTTCCTTTTTTATAAATTTTAATTTGATAACTCTGAG
GTCAAGCTAAAGGAAGCATGTTGTCTCCTGCTTCAATTTGTCTTGTGACT
GGAGCAACTTTTCAGTTTTTTAATGTTTTAGTTTTTTTCCGCTCTTCTGT
GAACATTGTTTCTGTTAAATGAGTGACTCGTTGATCTGCCCTATTTCTTA
TTTCGAGATTTTGTGGATAAGAAATTGATATGTGAT
back to top