CK933899

Overview
NameCK933899
Unique NameCK933899
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length806
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig239 contig Csv1_Contig239:79..884. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933899 vs. ExPASy Swiss-Prot
Match: TIP11_ARATH (Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1 PE=1 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 7.702e-102
Identity = 182/241 (75.52%), Postives = 196/241 (81.33%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGVWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVLFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFITS 799
            MPIRNIA+G P EAT PDAL+AALAEFISTLIFV AG GSGMAFNKLT NGA TPS                     NISGGHVNPAVTFGAF+GGNI+LLRGILYWIAQLLGS VACL+LKF T G    AF LS+GVGV NA VFEIVMTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF GASMNPAV FGPA+VSW+W NHWVYW GPL+GGG+AG++YE FFI +
Sbjct:    1 MPIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAAVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINT 241          
BLAST of CK933899 vs. ExPASy Swiss-Prot
Match: TIP11_ORYSJ (Probable aquaporin TIP1-1 OS=Oryza sativa subsp. japonica GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 9.743e-97
Identity = 177/240 (73.75%), Postives = 193/240 (80.42%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGVWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVLFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFIT 796
            MPIRNIAVG  +E  HP AL+AALAEFISTLIFVFAG+GSGMAF+KLT  GA TP+                     NISGGHVNPAVTFGAFVGGNI+L RG+LYWIAQLLGSTVAC LL+F T G  T  F L+ GV VW A+V EIVMTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANIL GGAFDGASMNPAV FGPALVSWSW++ WVYWVGPLIGGGLAG++YE  FI+
Sbjct:    1 MPIRNIAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIAAAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFLLRFSTGGLATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVSWSWESQWVYWVGPLIGGGLAGVIYEVLFIS 239          
BLAST of CK933899 vs. ExPASy Swiss-Prot
Match: TIP12_ARATH (Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2 PE=1 SV=2)

HSP 1 Score: 349.362 bits (895), Expect = 1.407e-95
Identity = 175/240 (72.92%), Postives = 190/240 (79.17%), Query Frame = 2
Query:   77 MPIRNIAVGHPREAT-HPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGVWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVLFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFI 793
            MP RNIA+G  +E   HP+ALRAALAEFISTLIFVFAG GSG+AFNK+T NGA TPS                     NISGGHVNPAVTFG  +GGNI+LLRGILYWIAQLLGS  AC LL F T G+   AF LS+GVG  NA+VFEIVMTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF GASMNPAV FGPA+VSW+W NHWVYW GPLIGGGLAGI+Y+F FI
Sbjct:    1 MPTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLVAAALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFI 240          
BLAST of CK933899 vs. ExPASy Swiss-Prot
Match: TIP11_MAIZE (Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 1.008e-93
Identity = 171/240 (71.25%), Postives = 187/240 (77.92%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGVWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVLFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFIT 796
            MPI  IA+G  +E  HP AL+AA AEFISTLIFVFAG+GSGMAF+KLT  G  TP+                     NISGGHVNPAVTFGAFVGGNI+L RG+LYW+AQLLGSTVAC LL+F T GQ T  F L+ GV VW A+V EIVMTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANIL GGAFDGASMNPAV FGPALVSW W   WVYWVGPLIGGGLAG++YE  FI+
Sbjct:    1 MPINRIALGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGPTTPAGLIAAAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFLLRFSTGGQATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFIS 239          
BLAST of CK933899 vs. ExPASy Swiss-Prot
Match: TIP1_MEDTR (Probable aquaporin TIP-type OS=Medicago truncatula GN=AQP1 PE=1 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 2.484e-92
Identity = 173/241 (71.78%), Postives = 190/241 (78.84%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGVWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVLFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFITS 799
            MPIRNIAVG P+EATHPD L+A LAEFIST IFVFAG GSG+A+NKLT++GA TP+                     NISGGHVNPAVTFGAFVGGNI+LLRGI+Y IAQLLGS VA  LL FVT   +  AF LS GVGV  A+V EIVMTFGLVYTVYATA+DPKKG++G IAPIAIGFIVGANIL GGAF GASMNPAV FGPA+VSWSW NHWVYW GPLIGGG+AG+VYE  FI S
Sbjct:    1 MPIRNIAVGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTNDGAATPAGLISASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIVYIIAQLLGSIVASALLVFVT-ASSVPAFGLSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPAVVSWSWSNHWVYWAGPLIGGGIAGLVYEVLFINS 240          
BLAST of CK933899 vs. ExPASy Swiss-Prot
Match: TIP12_ORYSJ (Probable aquaporin TIP1-2 OS=Oryza sativa subsp. japonica GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 4.236e-92
Identity = 163/239 (68.20%), Postives = 184/239 (76.99%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGVWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVLFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFI 793
            MP+  IAVG P E +HPD  +AA+AEFIS LIFVFAG GSGMAF+KLT  G  TPS                     NISGGHVNPAVTFGAFVGGNISL++ ++YW+AQLLGS VACLLLK  T G    AF+LS+GVG WNAVVFEIVMTFGLVYTVYATA+DPKKG LG IAPIAIGFIVGANILAGGAFDGASMNPAV FGPA+V+  WDNHWVYW+GP +G  +A ++Y+  FI
Sbjct:    1 MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGGTTPSGLIAASLAHALALFVAVAVGANISGGHVNPAVTFGAFVGGNISLVKAVVYWVAQLLGSVVACLLLKIATGGAAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVTGVWDNHWVYWLGPFVGAAIAALIYDIIFI 239          
BLAST of CK933899 vs. ExPASy Swiss-Prot
Match: TIP13_ARATH (Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3 PE=1 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.780e-90
Identity = 164/241 (68.05%), Postives = 184/241 (76.35%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGVWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVLFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFITS 799
            MPI  IA+G P EA+ PDA+RAA AEF S +IFVFAG+GSGMA+ KLT +G  TP+                     N+SGGHVNPAVTFGAF+GGNI+LLR ILYWIAQLLG+ VACLLLK  T G  T+AF+LS GV  WNAVVFEIVMTFGLVYTVYATA+DPKKG +G IAP+AIG IVGANIL GGAFDGASMNPAV FGPA+VSW W NHWVYWVGP IG  +A IVY+  FI S
Sbjct:    1 MPINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPAGLVAASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMNPAVSFGPAVVSWIWTNHWVYWVGPFIGAAIAAIVYDTIFIGS 241          
BLAST of CK933899 vs. ExPASy Swiss-Prot
Match: TIP12_MAIZE (Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 2.324e-90
Identity = 164/239 (68.62%), Postives = 184/239 (76.99%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGVWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVLFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFI 793
            MP+  IAVG P E +HPD  +AA+AEFISTLIFVFAG GSGMAF+KLT  GA TP+                     NISGGHVNPAVTFGAFVGGNISLL+ ++YW+AQLLGS VACLLLK  T G    AF+LS+GVG  NAVV E+VMTFGLVYTVYATA+DPKKG LG IAPIAIGFIVGANILAGGAFDGASMNPAV FGPA+V+  W+NHWVYWVGPL G  +A +VY+  FI
Sbjct:    1 MPVSRIAVGAPGELSHPDTAKAAVAEFISTLIFVFAGSGSGMAFSKLTDGGAATPAGLIAASLAHALALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKALVYWVAQLLGSVVACLLLKIATGGAALGAFSLSAGVGAMNAVVLEMVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVTGVWENHWVYWVGPLAGAAIAALVYDIIFI 239          
BLAST of CK933899 vs. ExPASy Swiss-Prot
Match: TIP1_MEDSA (Probable aquaporin TIP-type OS=Medicago sativa GN=MCP1 PE=2 SV=2)

HSP 1 Score: 330.487 bits (846), Expect = 6.763e-90
Identity = 171/241 (70.95%), Postives = 188/241 (78.01%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGVWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVLFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFITS 799
            MPIRNIAVG P+EATHPD L+A LAEFIST IFVFAG GSG+A+NKLT++GA TP+                     NISGGHVNPAV FGAFVGGNI+LLRGI+Y IAQLLGS V   LL FVT   +  AF LS GVGV  A+V EIVMTFGLVYTVYATA+DPKKG++G IAPIAIGFIVGANIL GGAF GASMNPAV FGPA+VSWSW NHWVYW GPLIGGG+AG+VYE  FI S
Sbjct:    1 MPIRNIAVGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTNDGAATPAGLISASIAHAFALFVAVSVGANISGGHVNPAV-FGAFVGGNITLLRGIVYIIAQLLGSIVCSALLVFVT-ASSVPAFGLSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPAVVSWSWSNHWVYWAGPLIGGGIAGLVYEVLFINS 239          
BLAST of CK933899 vs. ExPASy Swiss-Prot
Match: TIP31_MAIZE (Aquaporin TIP3-1 OS=Zea mays GN=TIP3-1 PE=2 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 1.120e-76
Identity = 135/242 (55.79%), Postives = 170/242 (70.25%), Query Frame = 2
Query:   74 IMPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGVWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVLFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFITS 799
            + P R   VG   +ATHPD +RAA++EFI+T IFVFA EGS ++  K+ H+  +T                       NISGGHVNPAVTFGA VGG +SL+R +LYW+AQLLG+  A LLL+  T G     FAL+SGVG W+AV+ E VMTFGL+Y  YAT +DPK+G +GTIAP+A+GF++GAN+LAGG FDGA MNPA +FGPALV W W +HWVYW+GP +G GLAG+VYE+  I S
Sbjct:    5 VRPGRRFTVGRSEDATHPDTIRAAISEFIATAIFVFAAEGSVLSLGKMYHD-MSTAGGLVAVALAHALALAVAVAVAVNISGGHVNPAVTFGALVGGRVSLVRAVLYWVAQLLGAVAATLLLRLATGGMRPPGFALASGVGDWHAVLLEAVMTFGLMYAYYATVIDPKRGHVGTIAPLAVGFLLGANVLAGGPFDGAGMNPARVFGPALVGWRWRHHWVYWLGPFLGAGLAGLVYEYLVIPS 245          
The following BLAST results are available for this feature:
BLAST of CK933899 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 190
Match NameE-valueIdentityDescription
TIP11_ARATH7.702e-10275.52Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1... [more]
TIP11_ORYSJ9.743e-9773.75Probable aquaporin TIP1-1 OS=Oryza sativa subsp. j... [more]
TIP12_ARATH1.407e-9572.92Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2... [more]
TIP11_MAIZE1.008e-9371.25Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1[more]
TIP1_MEDTR2.484e-9271.78Probable aquaporin TIP-type OS=Medicago truncatula... [more]
TIP12_ORYSJ4.236e-9268.20Probable aquaporin TIP1-2 OS=Oryza sativa subsp. j... [more]
TIP13_ARATH1.780e-9068.05Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3... [more]
TIP12_MAIZE2.324e-9068.62Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1[more]
TIP1_MEDSA6.763e-9070.95Probable aquaporin TIP-type OS=Medicago sativa GN=... [more]
TIP31_MAIZE1.120e-7655.79Aquaporin TIP3-1 OS=Zea mays GN=TIP3-1 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_H03 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_H03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933899 ID=CK933899|Name=CK933899|organism=Citrus sinensis|type=EST|length=806bp
GGGGAGACCAGTACACTTACGTGAACCAGTAGTAATCATACCCCAAAGGT
TCAATCTTCATCGTTTGATCTCCATCATGCCGATCAGAAACATTGCCGTT
GGCCATCCCCGTGAGGCGACTCATCCAGATGCCCTAAGGGCAGCCCTAGC
AGAGTTCATCTCAACTCTAATATTTGTCTTTGCCGGTGAAGGCTCGGGCA
TGGCCTTCAACAAGCTCACTCACAACGGCGCCAACACCCCCTCCGGCCTC
GTCGCCGCCTCTGTTGCTCACGCTTTCGCCCTTTTCGTTGCTGTCGCCGT
TGGCGCCAACATTTCCGGTGGCCACGTTAATCCTGCTGTCACCTTTGGCG
CCTTCGTTGGAGGTAACATCTCCCTTCTACGAGGCATCCTCTACTGGATC
GCCCAGCTTCTTGGATCCACCGTCGCATGCTTGCTTCTTAAGTTCGTTAC
CAACGGCCAGACCACATCTGCTTTTGCTCTCTCATCTGGAGTTGGTGTAT
GGAACGCAGTCGTTTTCGAGATCGTGATGACATTCGGACTAGTGTACACA
GTGTATGCCACAGCCCTGGACCCAAAGAAGGGAAGCTTGGGGACAATTGC
ACCAATTGCAATTGGTTTCATTGTAGGAGCCAACATCTTGGCGGGCGGGG
CGTTTGATGGAGCTTCAATGAACCCAGCAGTGTTATTCGGGCCAGCTTTG
GTAAGCTGGAGCTGGGACAACCACTGGGTCTACTGGGTCGGGCCACTCAT
CGGTGGTGGGCTAGCTGGCATCGTCTACGAGTTCTTCTTCATTACCAGTC
TCACGA
back to top