CK933901

Overview
NameCK933901
Unique NameCK933901
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length813
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6698 contig Csv1_Contig6698:1682..2493. BLAST: Citrus Unigene V1 Contigs to TAIR9
Homology
BLAST of CK933901 vs. ExPASy Swiss-Prot
Match: NU4C_CITSI (NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Citrus sinensis GN=ndhD PE=3 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 7.457e-125
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = -2
Query:    3 KKRIAYSSVSHMGFIILGIGSITDTGLNGAVLQIISHGLISAALFFLAGTSYDRIRFAYLDEMGGLAIPIPKIFTLFSILSMASLALPGMSGFVAELIVFFGIITSQKFFLMPKIVITFVMAIGMILTPIYS 398
            KKRIAYSSVSHMGFIILGIGSITDTGLNGAVLQIISHGLISAALFFLAGTSYDRIRFAYLDEMGGLAIPIPKIFTLFSILSMASLALPGMSGFVAELIVFFGIITSQKFFLMPKIVITFVMAIGMILTPIYS
Sbjct:  302 KKRIAYSSVSHMGFIILGIGSITDTGLNGAVLQIISHGLISAALFFLAGTSYDRIRFAYLDEMGGLAIPIPKIFTLFSILSMASLALPGMSGFVAELIVFFGIITSQKFFLMPKIVITFVMAIGMILTPIYS 433          

HSP 2 Score: 213.772 bits (543), Expect = 7.457e-125
Identity = 111/141 (78.72%), Postives = 112/141 (79.43%), Query Frame = -1
Query:  391 ATKFILYTAXXXXXXXXXXXXXXXXXSNEPTLNLETLVNRSYPVALEXXXXXXXXXXXAVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMGLLPHAHSIFSPWFMIVGTVQIIYAASTSPGQRNLKKK 813
            ATKFILYTA                 SNEPTLNLETLVNRSYPVALE           AVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINM LLPHAHSIFSPWFMIVGTVQIIYAASTSPGQRNLKK+
Sbjct:  164 ATKFILYTAGGSVFLLIGVLGIGLYGSNEPTLNLETLVNRSYPVALEIIFYIGFFIAFAVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHSIFSPWFMIVGTVQIIYAASTSPGQRNLKKR 304          
BLAST of CK933901 vs. ExPASy Swiss-Prot
Match: NU4C_GOSHI (NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Gossypium hirsutum GN=ndhD PE=3 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 2.448e-114
Identity = 119/132 (90.15%), Postives = 127/132 (96.21%), Query Frame = -2
Query:    3 KKRIAYSSVSHMGFIILGIGSITDTGLNGAVLQIISHGLISAALFFLAGTSYDRIRFAYLDEMGGLAIPIPKIFTLFSILSMASLALPGMSGFVAELIVFFGIITSQKFFLMPKIVITFVMAIGMILTPIYS 398
            KKRIAYSSVSHMGFII+GIGSITDTGLNGA+LQIISHG I AALFFLAGTSYDR+R  YLDEMGG+A+ IPKIFT+FSILSMASLALPGMSGFVAELIVFFGIITSQK+FLMPKI+ITFVMAIGMILTPIYS
Sbjct:  302 KKRIAYSSVSHMGFIIIGIGSITDTGLNGAILQIISHGFIGAALFFLAGTSYDRMRLVYLDEMGGMAVSIPKIFTMFSILSMASLALPGMSGFVAELIVFFGIITSQKYFLMPKILITFVMAIGMILTPIYS 433          

HSP 2 Score: 195.282 bits (495), Expect = 2.448e-114
Identity = 101/141 (71.63%), Postives = 106/141 (75.18%), Query Frame = -1
Query:  391 ATKFILYTAXXXXXXXXXXXXXXXXXSNEPTLNLETLVNRSYPVALEXXXXXXXXXXXAVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMGLLPHAHSIFSPWFMIVGTVQIIYAASTSPGQRNLKKK 813
            ATKFILYTA                 SNEPTLN ETL N+SYPVALE           AVK PIIP HTWLPDTHGEAHYSTCMLLAGILLKMGAYGL+RINM LLPHAHSIFSPW +IVGT+QIIYAASTS GQRNLKK+
Sbjct:  164 ATKFILYTAGGSVFLLIGVLGLGLYGSNEPTLNFETLANQSYPVALEIIFYIGFLIAFAVKSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFSPWLIIVGTMQIIYAASTSLGQRNLKKR 304          
BLAST of CK933901 vs. ExPASy Swiss-Prot
Match: NU4C_GOSBA (NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Gossypium barbadense GN=ndhD PE=3 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 2.448e-114
Identity = 119/132 (90.15%), Postives = 127/132 (96.21%), Query Frame = -2
Query:    3 KKRIAYSSVSHMGFIILGIGSITDTGLNGAVLQIISHGLISAALFFLAGTSYDRIRFAYLDEMGGLAIPIPKIFTLFSILSMASLALPGMSGFVAELIVFFGIITSQKFFLMPKIVITFVMAIGMILTPIYS 398
            KKRIAYSSVSHMGFII+GIGSITDTGLNGA+LQIISHG I AALFFLAGTSYDR+R  YLDEMGG+A+ IPKIFT+FSILSMASLALPGMSGFVAELIVFFGIITSQK+FLMPKI+ITFVMAIGMILTPIYS
Sbjct:  302 KKRIAYSSVSHMGFIIIGIGSITDTGLNGAILQIISHGFIGAALFFLAGTSYDRMRLVYLDEMGGMAVSIPKIFTMFSILSMASLALPGMSGFVAELIVFFGIITSQKYFLMPKILITFVMAIGMILTPIYS 433          

HSP 2 Score: 195.282 bits (495), Expect = 2.448e-114
Identity = 101/141 (71.63%), Postives = 106/141 (75.18%), Query Frame = -1
Query:  391 ATKFILYTAXXXXXXXXXXXXXXXXXSNEPTLNLETLVNRSYPVALEXXXXXXXXXXXAVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMGLLPHAHSIFSPWFMIVGTVQIIYAASTSPGQRNLKKK 813
            ATKFILYTA                 SNEPTLN ETL N+SYPVALE           AVK PIIP HTWLPDTHGEAHYSTCMLLAGILLKMGAYGL+RINM LLPHAHSIFSPW +IVGT+QIIYAASTS GQRNLKK+
Sbjct:  164 ATKFILYTAGGSVFLLIGVLGLGLYGSNEPTLNFETLANQSYPVALEIIFYIGFLIAFAVKSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFSPWLIIVGTMQIIYAASTSLGQRNLKKR 304          
BLAST of CK933901 vs. ExPASy Swiss-Prot
Match: NU4C_VITVI (NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Vitis vinifera GN=ndhD PE=3 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 4.168e-114
Identity = 120/132 (90.91%), Postives = 127/132 (96.21%), Query Frame = -2
Query:    3 KKRIAYSSVSHMGFIILGIGSITDTGLNGAVLQIISHGLISAALFFLAGTSYDRIRFAYLDEMGGLAIPIPKIFTLFSILSMASLALPGMSGFVAELIVFFGIITSQKFFLMPKIVITFVMAIGMILTPIYS 398
            KKRIAYSSVSHMGFII+GIGSITDTGLNGA+LQIISHG + AALFFLAGTSYDRIR  YLDEMGG+AIP+PKIFT+FSILSMASLALPGMSGFVAELIVFFGIITSQKF LMPKI+ITFVMAIGMILTPIYS
Sbjct:  302 KKRIAYSSVSHMGFIIIGIGSITDTGLNGAILQIISHGFLGAALFFLAGTSYDRIRLIYLDEMGGIAIPMPKIFTMFSILSMASLALPGMSGFVAELIVFFGIITSQKFLLMPKILITFVMAIGMILTPIYS 433          

HSP 2 Score: 193.356 bits (490), Expect = 4.168e-114
Identity = 99/141 (70.21%), Postives = 105/141 (74.47%), Query Frame = -1
Query:  391 ATKFILYTAXXXXXXXXXXXXXXXXXSNEPTLNLETLVNRSYPVALEXXXXXXXXXXXAVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMGLLPHAHSIFSPWFMIVGTVQIIYAASTSPGQRNLKKK 813
            ATKFILYTA                 SNEPTLN ET  N+SYPVALE           AVK PIIP HTWLPDTHGEAHYSTCMLLAGILLKMGAYGL+RINM LLPHAHSIFSPW ++VGT+QIIYAASTS GQRNLKK+
Sbjct:  164 ATKFILYTAGGSIFLLLGVLGIGLYGSNEPTLNFETSANQSYPVALEIIFYIGFFIAFAVKSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFSPWLVVVGTMQIIYAASTSSGQRNLKKR 304          
BLAST of CK933901 vs. ExPASy Swiss-Prot
Match: NU4C_BUXMI (NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Buxus microphylla GN=ndhD PE=3 SV=2)

HSP 1 Score: 231.491 bits (589), Expect = 7.095e-114
Identity = 117/132 (88.64%), Postives = 124/132 (93.94%), Query Frame = -2
Query:    3 KKRIAYSSVSHMGFIILGIGSITDTGLNGAVLQIISHGLISAALFFLAGTSYDRIRFAYLDEMGGLAIPIPKIFTLFSILSMASLALPGMSGFVAELIVFFGIITSQKFFLMPKIVITFVMAIGMILTPIYS 398
            KKRIAYSSVSHMGFII+GIGSITD GLNGA+LQIISHG I AALFFLAGTSYDRIR  YLDEMGG+AI +PKIFT+FS  SMASLALPGMSGFVAELIVFFGIITSQK+FLMPKI+ITFVMAIGMILTPIYS
Sbjct:  303 KKRIAYSSVSHMGFIIIGIGSITDAGLNGAILQIISHGFIGAALFFLAGTSYDRIRLIYLDEMGGIAIQMPKIFTMFSSFSMASLALPGMSGFVAELIVFFGIITSQKYFLMPKILITFVMAIGMILTPIYS 434          

HSP 2 Score: 199.519 bits (506), Expect = 7.095e-114
Identity = 103/141 (73.05%), Postives = 107/141 (75.89%), Query Frame = -1
Query:  391 ATKFILYTAXXXXXXXXXXXXXXXXXSNEPTLNLETLVNRSYPVALEXXXXXXXXXXXAVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMGLLPHAHSIFSPWFMIVGTVQIIYAASTSPGQRNLKKK 813
            ATKFILYTA                 SNEPTLN ETL N+SYPVALE           AVK PIIP HTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINM LLPHAHSIFSPW +IVGT+QIIYAASTSPGQRNLKK+
Sbjct:  165 ATKFILYTAGGSIFLLMGVLGMDLYGSNEPTLNFETLANQSYPVALEILFYFGFIIAFAVKSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHSIFSPWLVIVGTMQIIYAASTSPGQRNLKKR 305          
BLAST of CK933901 vs. ExPASy Swiss-Prot
Match: NU4C_SPIOL (NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Spinacia oleracea GN=ndhD PE=2 SV=2)

HSP 1 Score: 225.328 bits (573), Expect = 7.095e-114
Identity = 112/131 (85.50%), Postives = 122/131 (93.13%), Query Frame = -2
Query:    6 KKRIAYSSVSHMGFIILGIGSITDTGLNGAVLQIISHGLISAALFFLAGTSYDRIRFAYLDEMGGLAIPIPKIFTLFSILSMASLALPGMSGFVAELIVFFGIITSQKFFLMPKIVITFVMAIGMILTPIY 398
            KKRIAYSSVSHMGFII+GI SITDTGLNGA+LQIISHG I AALFFLAGTSYDRIR  YLDEMGG+AIP+PKIFTLFS  SMASLALPGMSGF+AELIVFFG+ITSQK+ L+PK++ITF MAIGMILTPIY
Sbjct:  302 KKRIAYSSVSHMGFIIIGISSITDTGLNGAILQIISHGFIGAALFFLAGTSYDRIRLVYLDEMGGIAIPMPKIFTLFSSFSMASLALPGMSGFIAELIVFFGLITSQKYLLIPKLLITFGMAIGMILTPIY 432          

HSP 2 Score: 205.682 bits (522), Expect = 7.095e-114
Identity = 105/141 (74.47%), Postives = 110/141 (78.01%), Query Frame = -1
Query:  391 ATKFILYTAXXXXXXXXXXXXXXXXXSNEPTLNLETLVNRSYPVALEXXXXXXXXXXXAVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMGLLPHAHSIFSPWFMIVGTVQIIYAASTSPGQRNLKKK 813
            ATKFILYTA                 SNEPTLNLETLVN+SYPVALE           AVKLPIIP HTWLPDTHGEAHYSTCMLLAGILLKMGAYGL+RINM LLPHAHSIFSPW MI+GT+QIIYAASTSPGQRNLKK+
Sbjct:  164 ATKFILYTAGGSIFLLMGVLGVGLYGSNEPTLNLETLVNQSYPVALEIIFYIGFFIAFAVKLPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFSPWLMIIGTMQIIYAASTSPGQRNLKKR 304          
BLAST of CK933901 vs. ExPASy Swiss-Prot
Match: NU4C_PANGI (NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Panax ginseng GN=ndhD PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.208e-113
Identity = 116/132 (87.88%), Postives = 125/132 (94.70%), Query Frame = -2
Query:    3 KKRIAYSSVSHMGFIILGIGSITDTGLNGAVLQIISHGLISAALFFLAGTSYDRIRFAYLDEMGGLAIPIPKIFTLFSILSMASLALPGMSGFVAELIVFFGIITSQKFFLMPKIVITFVMAIGMILTPIYS 398
            KKRIAYSSVSHMGFI++GIGSITDTGLNGA+LQIISHG I AALFFLAGTSYDRIR  YLDEMGG+AIP+PKIFT+F+  SMASLALPGMSGFVAELIVFFGIITSQK+ LMPKI+ITFVMAIGMILTPIYS
Sbjct:  302 KKRIAYSSVSHMGFILIGIGSITDTGLNGAILQIISHGFIGAALFFLAGTSYDRIRLVYLDEMGGIAIPMPKIFTMFTSFSMASLALPGMSGFVAELIVFFGIITSQKYLLMPKILITFVMAIGMILTPIYS 433          

HSP 2 Score: 197.593 bits (501), Expect = 1.208e-113
Identity = 102/141 (72.34%), Postives = 106/141 (75.18%), Query Frame = -1
Query:  391 ATKFILYTAXXXXXXXXXXXXXXXXXSNEPTLNLETLVNRSYPVALEXXXXXXXXXXXAVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMGLLPHAHSIFSPWFMIVGTVQIIYAASTSPGQRNLKKK 813
            AT FILYTA                 SNEPTLN ET VN+SYPVALE           AVK PIIP HTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINM LLPHAHSIFSPW +IVGT+QIIYAASTSPGQRNLKK+
Sbjct:  164 ATNFILYTAGGSIFLLMGVLGVGLYGSNEPTLNFETSVNQSYPVALEIIFYIGFFIAFAVKSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHSIFSPWLVIVGTIQIIYAASTSPGQRNLKKR 304          
BLAST of CK933901 vs. ExPASy Swiss-Prot
Match: NU4C_LOBMA (NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Lobularia maritima GN=ndhD PE=3 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 2.684e-113
Identity = 115/131 (87.79%), Postives = 123/131 (93.89%), Query Frame = -2
Query:    6 KKRIAYSSVSHMGFIILGIGSITDTGLNGAVLQIISHGLISAALFFLAGTSYDRIRFAYLDEMGGLAIPIPKIFTLFSILSMASLALPGMSGFVAELIVFFGIITSQKFFLMPKIVITFVMAIGMILTPIY 398
            KKRIAYSSVSHMGFII+GIGSITD GLNGA+LQIISHG I AALFFLAGTSYDRIR  YLDEMGG+AI IPKIFT+F+ILSMASLALPGMSGFVAELIVFFGIITSQK+FL+ KI+I FVMAIGMILTPIY
Sbjct:  302 KKRIAYSSVSHMGFIIIGIGSITDPGLNGAILQIISHGFIGAALFFLAGTSYDRIRLGYLDEMGGMAISIPKIFTMFTILSMASLALPGMSGFVAELIVFFGIITSQKYFLISKILIIFVMAIGMILTPIY 432          

HSP 2 Score: 202.216 bits (513), Expect = 2.684e-113
Identity = 102/141 (72.34%), Postives = 108/141 (76.60%), Query Frame = -1
Query:  391 ATKFILYTAXXXXXXXXXXXXXXXXXSNEPTLNLETLVNRSYPVALEXXXXXXXXXXXAVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMGLLPHAHSIFSPWFMIVGTVQIIYAASTSPGQRNLKKK 813
            ATKFILYTA                 SNEPTLNLE L N+SYPV LE           AVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGL+RINM LLPHAHS+FSPW M+VGT+QIIYAASTSPGQRNLKK+
Sbjct:  164 ATKFILYTAGSSIFLLIGVLGISLYGSNEPTLNLELLANQSYPVTLEILLYIGFLIAFAVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSMFSPWLMVVGTIQIIYAASTSPGQRNLKKR 304          
BLAST of CK933901 vs. ExPASy Swiss-Prot
Match: NU4C_LACSA (NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Lactuca sativa GN=ndhD PE=3 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 3.501e-113
Identity = 113/132 (85.61%), Postives = 122/132 (92.42%), Query Frame = -2
Query:    3 KKRIAYSSVSHMGFIILGIGSITDTGLNGAVLQIISHGLISAALFFLAGTSYDRIRFAYLDEMGGLAIPIPKIFTLFSILSMASLALPGMSGFVAELIVFFGIITSQKFFLMPKIVITFVMAIGMILTPIYS 398
            KKRIAYSSVSHMGFI++GI SITDTGLNGA+LQIISHG I AALFFLAGTSYDRIR  YLD+MGG+AIP+PKIFT+FS  SMASLALPGMSGFVAE+IVF GIITSQK+ LMPKI ITFVMAIGMILTPIYS
Sbjct:  302 KKRIAYSSVSHMGFILIGIASITDTGLNGAILQIISHGFIGAALFFLAGTSYDRIRLVYLDQMGGVAIPMPKIFTMFSSFSMASLALPGMSGFVAEVIVFLGIITSQKYLLMPKIAITFVMAIGMILTPIYS 433          

HSP 2 Score: 202.601 bits (514), Expect = 3.501e-113
Identity = 104/141 (73.76%), Postives = 108/141 (76.60%), Query Frame = -1
Query:  391 ATKFILYTAXXXXXXXXXXXXXXXXXSNEPTLNLETLVNRSYPVALEXXXXXXXXXXXAVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMGLLPHAHSIFSPWFMIVGTVQIIYAASTSPGQRNLKKK 813
            ATKFILYTA                 SNEPTLN ET VN+SYPVALE           AVKLPI+P HTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINM LLPHAHSIFSPW MIVGT+QIIYAASTSPGQRNLKK+
Sbjct:  164 ATKFILYTAGGSIFLLMGVLGVGLSGSNEPTLNFETSVNQSYPVALEIIFYIGFFIAFAVKLPILPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHSIFSPWLMIVGTIQIIYAASTSPGQRNLKKR 304          
BLAST of CK933901 vs. ExPASy Swiss-Prot
Match: NU4C_NANDO (NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Nandina domestica GN=ndhD PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 5.961e-113
Identity = 116/132 (87.88%), Postives = 123/132 (93.18%), Query Frame = -2
Query:    3 KKRIAYSSVSHMGFIILGIGSITDTGLNGAVLQIISHGLISAALFFLAGTSYDRIRFAYLDEMGGLAIPIPKIFTLFSILSMASLALPGMSGFVAELIVFFGIITSQKFFLMPKIVITFVMAIGMILTPIYS 398
            KKRIAYSSVSHMGF ILGI SITDTGLNGA+LQ+ISHG I AALFFLAGTSYDRIR  YLDEMGG+AIP+PKIFTLFS  SMASLALPGMSGFVAEL+VFFGIITS+KFFLMPKI+ITFV AIGMILTPIYS
Sbjct:  302 KKRIAYSSVSHMGFTILGISSITDTGLNGAILQMISHGFIGAALFFLAGTSYDRIRLVYLDEMGGIAIPMPKIFTLFSSFSMASLALPGMSGFVAELVVFFGIITSEKFFLMPKILITFVTAIGMILTPIYS 433          

HSP 2 Score: 197.593 bits (501), Expect = 5.961e-113
Identity = 102/141 (72.34%), Postives = 106/141 (75.18%), Query Frame = -1
Query:  391 ATKFILYTAXXXXXXXXXXXXXXXXXSNEPTLNLETLVNRSYPVALEXXXXXXXXXXXAVKLPIIPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMGLLPHAHSIFSPWFMIVGTVQIIYAASTSPGQRNLKKK 813
            ATKFILYTA                 SNEPTLN ET  N+SYPVALE           AVKLPIIP HTWLPDTHGEAHYSTCMLLAGILLKMGAYGL+RINM LLPHAHSIFSPW MIVGT+QIIYAASTS GQRNLKK+
Sbjct:  164 ATKFILYTAGGSIFLLIGVSGMGLYGSNEPTLNFETSANQSYPVALEILLYFGFFIAYAVKLPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFSPWLMIVGTIQIIYAASTSLGQRNLKKR 304          
The following BLAST results are available for this feature:
BLAST of CK933901 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 308
Match NameE-valueIdentityDescription
NU4C_CITSI7.457e-125100.00NAD(P)H-quinone oxidoreductase chain 4, chloroplas... [more]
NU4C_GOSHI2.448e-11490.15NAD(P)H-quinone oxidoreductase chain 4, chloroplas... [more]
NU4C_GOSBA2.448e-11490.15NAD(P)H-quinone oxidoreductase chain 4, chloroplas... [more]
NU4C_VITVI4.168e-11490.91NAD(P)H-quinone oxidoreductase chain 4, chloroplas... [more]
NU4C_BUXMI7.095e-11488.64NAD(P)H-quinone oxidoreductase chain 4, chloroplas... [more]
NU4C_SPIOL7.095e-11485.50NAD(P)H-quinone oxidoreductase chain 4, chloroplas... [more]
NU4C_PANGI1.208e-11387.88NAD(P)H-quinone oxidoreductase chain 4, chloroplas... [more]
NU4C_LOBMA2.684e-11387.79NAD(P)H-quinone oxidoreductase chain 4, chloroplas... [more]
NU4C_LACSA3.501e-11385.61NAD(P)H-quinone oxidoreductase chain 4, chloroplas... [more]
NU4C_NANDO5.961e-11387.88NAD(P)H-quinone oxidoreductase chain 4, chloroplas... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_H05 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_H05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933901 ID=CK933901|Name=CK933901|organism=Citrus sinensis|type=EST|length=813bp
GGGGAATAAATAGGAGTTAATATCATTCCAATTGCCATTACAAAAGTGAT
TACTATTTTTGGCATTAAAAAAAATTTTTGGCTGGTAATTATTCCAAAAA
ATACTATCAATTCTGCAACAAAACCACTCATGCCGGGTAATGCAAGGGAG
GCCATCGATAAGATACTGAATAGCGTGAAGATCTTTGGAATTGGTATAGC
TAGTCCGCCCATTTCGTCTAGATAAGCAAAACGTATTCTATCATAACTCG
TTCCTGCCAAGAAAAAAAGTGCAGCACTAATCAACCCATGAGAAATTATT
TGTAAAACGGCTCCATTGAGACCTGTATCGGTTATCGAGCCTATTCCTAG
AATTATGAAACCCATATGAGATACAGAGGAATAGGCTATTCTTTTTTTTT
AAATTCCGTTGGCCGGGAGATGTTGAAGCTGCATAAATTATTTGCACGGT
ACCTACTATCATGAACCAGGGGGAAAATATAGAATGAGCGTGCGGTAATA
GTCCCATATTGATTCGAATCAACCCATATGCTCCCATTTTTAATAAGATT
CCGGCTAGAAGCATACAAGTACTGTAATGTGCCTCTCCGTGGGTGTCTGG
TAACCACGTATGAAAGGGTATAATTGGCAATTTGACAGCAAAAGCAATAA
AAAATCCAATATAGAATATTATTTCCAGTGCCACAGGATACGACCGATTA
ACTAATGTTTCCAAATTTAATGTTGGTTCATTGGAACCATATAAACCGAT
ACCCAAAACTCCTATTAAAAGAAAAACGGAGCCTCCTGCCGTGTACAAAA
TAAATTTTGTGGC
back to top