CK933903

Overview
NameCK933903
Unique NameCK933903
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length854
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933903_ssr242 microsatellite CK933903_ssr242:242..253. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1886 contig Csv1_Contig1886:3..856. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933903 vs. ExPASy Swiss-Prot
Match: MOMAS_ORYSJ (Momilactone A synthase OS=Oryza sativa subsp. japonica GN=Os04g0179200 PE=2 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 3.451e-71
Identity = 143/259 (55.21%), Postives = 186/259 (71.81%), Query Frame = 2
Query:   89 RRLQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIXXXXXXXXXXXYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFERILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGLMKNTAVELGRFGIRVNCVSPYVVSTPLAKDFLKLADDGLGGMY---SNLKGA-VLEPEDIAEAALYLGSDESKCVSGHNLVVDGGFAIVN 853
            R+L GKVA+ITGGA GIG CTARLF KHGA+V++ADI+D+LG S+  ++           YVHCDVT E D+  AV+ AV ++GKLD+MFNNAG        + +  + +FER+L++NLVG FLGTKHAARVM PA RGSIISTAS+   + GAA+HAY +SKH L+G  +N A ELGR GIRVNCVSP  V+TPLA+  + + D+ +  +    +NLKGA  L+ +DIA AAL+L SD+ + VSG NL VDGG ++VN
Sbjct:   13 RKLVGKVAVITGGASGIGACTARLFVKHGARVVVADIQDELGASLVAELGPDASS-----YVHCDVTNEGDVAAAVDHAVARFGKLDVMFNNAGVSGPPCFRMSECTKEDFERVLAVNLVGPFLGTKHAARVMAPARRGSIISTASLSSSVSGAASHAYTTSKHALVGFTENAAGELGRHGIRVNCVSPAGVATPLARAAMGMDDEAIEAIMANSANLKGAGALKADDIAAAALFLASDDGRYVSGQNLRVDGGLSVVN 266          
BLAST of CK933903 vs. ExPASy Swiss-Prot
Match: ABA2_ARATH (Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 5.900e-63
Identity = 131/264 (49.62%), Postives = 166/264 (62.88%), Query Frame = 2
Query:   89 RRLQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIXXXXXXXXXXXYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFERILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGLMKNTAVELGRFGIRVNCVSPYVVSTPLAKDFL---KLADDGLGGM------YSNLKGAVLEPEDIAEAALYLGSDESKCVSGHNLVVDGGFAIVN 853
            +RL GKVALITGGA GIGE   RLF KHGAKV I D++DDLG  VCK +           ++H DV  E DI NAV+ AV  +G LDI+ NNAG      P+I +   +EFE    +N+ GAFL  KHAARVM P  +GSI+S  SV G++GG   H+Y  SKH +LGL ++ A ELG+ GIRVNCVSPY V+T LA   L   +  +D   G        +NLKG  L  +D+A A L+L SD+S+ +SG NL++DGGF   N
Sbjct:   16 QRLLGKVALITGGATGIGESIVRLFHKHGAKVCIVDLQDDLGGEVCKSLLRGESKETAF-FIHGDVRVEDDISNAVDFAVKNFGTLDILINNAGLCGAPCPDIRNYSLSEFEMTFDVNVKGAFLSMKHAARVMIPEKKGSIVSLCSVGGVVGGVGPHSYVGSKHAVLGLTRSVAAELGQHGIRVNCVSPYAVATKLALAHLPEEERTEDAFVGFRNFAAANANLKGVELTVDDVANAVLFLASDDSRYISGDNLMIDGGFTCTN 278          
BLAST of CK933903 vs. ExPASy Swiss-Prot
Match: TS2_MAIZE (Sex determination protein tasselseed-2 OS=Zea mays GN=TS2 PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 7.464e-58
Identity = 128/282 (45.39%), Postives = 169/282 (59.93%), Query Frame = 2
Query:   89 RRLQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIXXXXXXXXXXXYVHCDVTKEKDIENAVNTAVTQYG-KLDIMFNNAGTVDE---VKPNILDNDQAEFERILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGLMKNTAVELGRFGIRVNCVSPYVVSTP----------------------LAKDFLKLADDGLGGM------YSNLKGAVLEPEDIAEAALYLGSDESKCVSGHNLVVDGG 838
            +RL GKVA++TGGARGIGE   RLF+KHGA+V+IADI D  GE++   +           +V CDV+ E D+  AV+ A++++G +LD+  NNAG +        +IL  D AEF+R+L +N +GA LG KHAAR M P   GSI+S ASV  ++GG   HAY +SKH ++GL KN A EL   G+RVNCVSP+ V+TP                      L  D    +D  +  M       + LKG  L P DIAEA L+L SDE++ +SGHNLVVDGG
Sbjct:   51 KRLDGKVAIVTGGARGIGEAIVRLFAKHGARVVIADIDDAAGEALASALGPQVS------FVRCDVSVEDDVRRAVDWALSRHGGRLDVYCNNAGVLGRQTRAARSILSFDAAEFDRVLRVNALGAALGMKHAARAMAPRRAGSIVSVASVAAVLGGLGPHAYTASKHAIVGLTKNAACELRAHGVRVNCVSPFGVATPMLINAWRQGHDDATADADRDLDLDLDVTVPSDQEVEKMEEVVRGLATLKGPTLRPRDIAEAVLFLASDEARYISGHNLVVDGG 326          
BLAST of CK933903 vs. ExPASy Swiss-Prot
Match: HSD_MYCTU (3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis GN=fabG3 PE=1 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 3.366e-42
Identity = 102/249 (40.96%), Postives = 142/249 (57.03%), Query Frame = 2
Query:   92 RLQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIXXXXXXXXXXXYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFERILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGLMKNTAVELGRFGIRVNCVSPYVVSTPLAKDFLKLADDGLGGMYSNLKGAVLEPEDIAEAALYLGSDESKCVSGHNLVVDGG 838
            RL GKVAL++GGARG+G    R     GAKV+  DI D+ G++V  ++           YVH DVT+      AV+TAVT +G L ++ NNAG ++     I D    E++RIL +NL G FLG +   + MK AGRGSII+ +S+ G+ G  A H Y ++K  + GL K+TA+ELG  GIRVN + P +V TP       + D     ++    G   EP +++   +YL SDES   +G   VVDGG
Sbjct:    4 RLIGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAVAAELADAAR------YVHLDVTQPAQWTAAVDTAVTAFGGLHVLVNNAGILNI--GTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTP-------MTDWVPEDIFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGG 237          
BLAST of CK933903 vs. ExPASy Swiss-Prot
Match: HSD_MYCBO (3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis GN=fabG3 PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 3.366e-42
Identity = 102/249 (40.96%), Postives = 142/249 (57.03%), Query Frame = 2
Query:   92 RLQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIXXXXXXXXXXXYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFERILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGLMKNTAVELGRFGIRVNCVSPYVVSTPLAKDFLKLADDGLGGMYSNLKGAVLEPEDIAEAALYLGSDESKCVSGHNLVVDGG 838
            RL GKVAL++GGARG+G    R     GAKV+  DI D+ G++V  ++           YVH DVT+      AV+TAVT +G L ++ NNAG ++     I D    E++RIL +NL G FLG +   + MK AGRGSII+ +S+ G+ G  A H Y ++K  + GL K+TA+ELG  GIRVN + P +V TP       + D     ++    G   EP +++   +YL SDES   +G   VVDGG
Sbjct:    4 RLIGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAVAAELADAAR------YVHLDVTQPAQWTAAVDTAVTAFGGLHVLVNNAGILNI--GTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTP-------MTDWVPEDIFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGG 237          
BLAST of CK933903 vs. ExPASy Swiss-Prot
Match: BACC2_BACSU (Bacilysin biosynthesis oxidoreductase bacC OS=Bacillus subtilis GN=bacC PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.239e-36
Identity = 92/255 (36.08%), Postives = 144/255 (56.47%), Query Frame = 2
Query:   95 LQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIXXXXXXXXXXXYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFERILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGLMKNTAVELGRFGIRVNCVSPYVVSTPL-AKDFLKLADDGLGGMYS-----NLKGAVLEPEDIAEAALYLGSDESKCVSGHNLVVDGGF 841
            L  K  LITGGA GIG    + F    A V++ADI +  GE++ +             +VH D+T E   +NA+ +AV ++G LD++ NNAG   E+   I + + + + ++L++NL G FL +KHA + M  +G+G+II+T SV G++      AY +SK G+L L ++ AV+  +  IRVNCV P ++ TPL  K FL+  +  L  +       N    + +PE+IA   L+L SD S  ++G  +  DGG+
Sbjct:    3 LTDKTVLITGGASGIGYAAVQAFLNQQANVVVADIDEAQGEAMIRK-----ENNDRLHFVHTDITDEPACQNAIRSAVDKFGGLDVLINNAGI--EIVAPIHEMELSNWNKVLNVNLTGMFLMSKHALKYMLKSGKGNIINTCSVGGVVAWPDIPAYNASKGGVLQLTRSMAVDYAKHNIRVNCVCPGIIDTPLNEKSFLENNEGTLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGGY 250          
BLAST of CK933903 vs. ExPASy Swiss-Prot
Match: CPNA_COMTE (Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.618e-36
Identity = 87/250 (34.80%), Postives = 136/250 (54.40%), Query Frame = 2
Query:   92 RLQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIXXXXXXXXXXXYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFERILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGLMKNTAVELGRFGIRVNCVSPYVVSTPLAKDFLKLADDGLGGMYSNLKGAVLEPEDIAEAALYLGSDESKCVSGHNLVVDGGF 841
            R+  KV L+TGGA G+G     L ++ GA V ++D+ ++LG     +I           ++H DVT E     AV+T + +  +LD + NNAG +  +KP + D    E++RI  IN+   FLGT+     M+ A +G I++ +S+ G++G     AY +SK  +    K  AV+L  F IRVN V P V++TP+ +  L         +   L G   +P ++++A L+L SDE+  V G  LVVDGG+
Sbjct:    3 RVNDKVVLVTGGAMGMGLTHCTLLAREGATVYLSDMNEELGHQAVAEIRRQGGKAH---FLHLDVTNENHWTGAVDTILAESDRLDALVNNAGILT-LKP-VQDTSNEEWDRIFEINVRSVFLGTRAVIEPMRKAHKGCIVNVSSIYGLVGAPGAAAYEASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIATPMTQQILDAPQSARALLGPTLLGRAAQPMEVSQAVLFLVSDEASFVHGSELVVDGGY 247          
BLAST of CK933903 vs. ExPASy Swiss-Prot
Match: CPNA_COMS9 (Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.618e-36
Identity = 87/250 (34.80%), Postives = 136/250 (54.40%), Query Frame = 2
Query:   92 RLQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIXXXXXXXXXXXYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFERILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGLMKNTAVELGRFGIRVNCVSPYVVSTPLAKDFLKLADDGLGGMYSNLKGAVLEPEDIAEAALYLGSDESKCVSGHNLVVDGGF 841
            R+  KV L+TGGA G+G     L ++ GA V ++D+ ++LG     +I           ++H DVT E     AV+T + +  +LD + NNAG +  +KP + D    E++RI  IN+   FLGT+     M+ A +G I++ +S+ G++G     AY +SK  +    K  AV+L  F IRVN V P V++TP+ +  L         +   L G   +P ++++A L+L SDE+  V G  LVVDGG+
Sbjct:    3 RVNDKVVLVTGGAMGMGLTHCTLLAREGATVYLSDMNEELGHQAVAEIRRQGGKAH---FLHLDVTNENHWTGAVDTILAESDRLDALVNNAGILT-LKP-VQDTSNEEWDRIFEINVRSVFLGTRAVIEPMRKAHKGCIVNVSSIYGLVGAPGAAAYEASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIATPMTQQILDAPQSARALLGPTLLGRAAQPMEVSQAVLFLVSDEASFVHGSELVVDGGY 247          
BLAST of CK933903 vs. ExPASy Swiss-Prot
Match: BACC_BACSU (Bacilysin biosynthesis oxidoreductase bacC OS=Bacillus subtilis GN=bacC PE=3 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 6.798e-35
Identity = 93/255 (36.47%), Postives = 142/255 (55.69%), Query Frame = 2
Query:   95 LQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIXXXXXXXXXXXYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAEFERILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGLMKNTAVELGRFGIRVNCVSPYVVSTPL-AKDFLKLADDGLGGMYS-----NLKGAVLEPEDIAEAALYLGSDESKCVSGHNLVVDGGF 841
            L  K  LITGGA GIG    + F    A V++ADI +  GE++ +             +V  D+T E   ++AV +AV  +G LD++ NNAG   E+   I + + +++ ++L +NL G FL +KHA + M  AG+G+II+T SV G++      AY +SK G+L L K+ AV+  +  IRVNCV P ++ TPL  K FL+  +  L  +       N    + +PE+IA   L+L SD S  ++G  +  DGG+
Sbjct:    3 LTDKTVLITGGASGIGYAAVQAFLGQQANVVVADIDEAQGEAMVRK-----ENNDRLHFVQTDITDEAACQHAVESAVHTFGGLDVLINNAGI--EIVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGKGNIINTCSVGGLVAWPDIPAYNASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIDTPLNEKSFLENNEGTLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGGY 250          
BLAST of CK933903 vs. ExPASy Swiss-Prot
Match: HSD_STREX (3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Streptomyces exfoliatus PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.978e-34
Identity = 97/251 (38.65%), Postives = 137/251 (54.58%), Query Frame = 2
Query:   95 LQGKVALITGGARGIGECTARLFSKHGAKVLIADIKDDLGESVCKDIXXXXXXXXXXXYVHCDVTKEKDIENAVNTAVTQYGKLDIMFNNAGTVDEVKPNILDNDQAE-FERILSINLVGAFLGTKHAARVMKPAGRGSIISTASVCGIIGGAATHAYASSKHGLLGLMKNTAVELGRFGIRVNCVSPYVVSTPLAKDFLKLADDGLGGMYSNLKGAV-LEPEDIAEAALYLGSDESKCVSGHNLVVDGGF 841
            L GK  +ITGGARG+G   AR     GA+V++AD+ D+ G +  +++           Y H DVT E+D +  V  A  ++G +D + NNAG    +    L+ +  E F +++ INL G F+G K     MK AG GSI++ +S  G++G A T +Y +SK G+ GL K  AVELG   IRVN V P +  TP+  +       G G   +   G V  EP +IA A + L SD S  V+G  L VDGG+
Sbjct:    4 LSGKTVIITGGARGLGAEAARQAVAAGARVVLADVLDEEGAATARELGDAAR------YQHLDVTIEEDWQRVVAYAREEFGSVDGLVNNAGISTGM---FLETESVERFRKVVDINLTGVFIGMKTVIPAMKDAGGGSIVNISSAAGLMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTPMTAE--TGIRQGEGNYPNTPMGRVGNEPGEIAGAVVKLLSDTSSYVTGAELAVDGGW 243          
The following BLAST results are available for this feature:
BLAST of CK933903 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 330
Match NameE-valueIdentityDescription
MOMAS_ORYSJ3.451e-7155.21Momilactone A synthase OS=Oryza sativa subsp. japo... [more]
ABA2_ARATH5.900e-6349.62Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN... [more]
TS2_MAIZE7.464e-5845.39Sex determination protein tasselseed-2 OS=Zea mays... [more]
HSD_MYCTU3.366e-4240.963-alpha-(or 20-beta)-hydroxysteroid dehydrogenase ... [more]
HSD_MYCBO3.366e-4240.963-alpha-(or 20-beta)-hydroxysteroid dehydrogenase ... [more]
BACC2_BACSU1.239e-3636.08Bacilysin biosynthesis oxidoreductase bacC OS=Baci... [more]
CPNA_COMTE1.618e-3634.80Cyclopentanol dehydrogenase OS=Comamonas testoster... [more]
CPNA_COMS91.618e-3634.80Cyclopentanol dehydrogenase OS=Comamonas sp. (stra... [more]
BACC_BACSU6.798e-3536.47Bacilysin biosynthesis oxidoreductase bacC OS=Baci... [more]
HSD_STREX1.978e-3438.653-alpha-(or 20-beta)-hydroxysteroid dehydrogenase ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_H07 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_H07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933903 ID=CK933903|Name=CK933903|organism=Citrus sinensis|type=EST|length=854bp
GGGGCAAGACACCATAACTTACCTTCATATTTTGGTTGCTGTGCGTGCTA
TAAGAATGGGCAGTGCTTCAGTTGTCTCAGCTGCAGCAAGAAGGCTACAA
GGCAAAGTGGCACTTATCACAGGAGGAGCAAGAGGCATTGGGGAATGCAC
TGCAAGGCTCTTCTCAAAACATGGAGCTAAAGTACTCATTGCAGATATTA
AAGATGACTTGGGCGAATCTGTATGCAAAGACATAGGCTCTTCATCATCA
TCAGCCAGCGGCTGCTCCTATGTCCATTGTGATGTAACCAAAGAGAAAGA
TATCGAAAACGCCGTTAACACGGCAGTCACTCAGTACGGAAAGCTAGACA
TTATGTTCAATAACGCCGGCACTGTGGATGAAGTCAAACCTAACATACTC
GATAACGATCAGGCTGAATTTGAGCGCATACTTTCCATTAACCTCGTTGG
CGCATTTTTGGGGACGAAACATGCTGCTAGGGTGATGAAACCCGCCGGAC
GAGGCAGCATAATTTCAACTGCGAGCGTTTGCGGAATCATTGGTGGCGCT
GCAACACATGCATACGCTAGTTCAAAGCATGGCCTTTTGGGGCTGATGAA
GAATACTGCTGTGGAGCTTGGACGATTTGGCATTAGGGTCAATTGTGTGT
CACCTTATGTGGTCTCAACTCCATTAGCTAAGGATTTTCTCAAGCTTGCT
GATGATGGTTTGGGCGGCATGTATTCAAATCTTAAGGGGGCTGTTCTTGA
GCCTGAGGATATAGCTGAAGCTGCTCTTTATTTGGGGAGTGATGAGTCTA
AGTGTGTGAGTGGGCATAATTTGGTCGTAGATGGAGGATTTGCTATTGTC
AATG
back to top