CK933910

Overview
NameCK933910
Unique NameCK933910
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length879
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig239 contig Csv1_Contig239:79..957. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933910 vs. ExPASy Swiss-Prot
Match: TIP11_ARATH (Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1 PE=1 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 1.076e-107
Identity = 190/251 (75.70%), Postives = 206/251 (82.07%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 829
            MPIRNIA+G P EAT PDAL+AALAEFISTLIFV AG GSGMAFNKLT NGA TPS                     NISGGHVNPAVTFGAF+GGNI+LLRGILYWIAQLLGS VACL+LKF T G    AF LS+GVG  NA VFEIVMTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF GASMNPAV+FGPA+VSW+W NHWVYW GPL+GGG+AG++YE FFIN +HEQLPTT+Y
Sbjct:    1 MPIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVAAAVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFINTTHEQLPTTDY 251          
BLAST of CK933910 vs. ExPASy Swiss-Prot
Match: TIP11_ORYSJ (Probable aquaporin TIP1-1 OS=Oryza sativa subsp. japonica GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 1.361e-102
Identity = 185/251 (73.71%), Postives = 203/251 (80.88%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 829
            MPIRNIAVG  +E  HP AL+AALAEFISTLIFVFAG+GSGMAF+KLT  GA TP+                     NISGGHVNPAVTFGAFVGGNI+L RG+LYWIAQLLGSTVAC LL+F T G  T  F L+ GV  W A+V EIVMTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANIL GGAFDGASMNPAVSFGPALVSWSW++ WVYWVGPLIGGGLAG++YE  FI+ +HEQLPTT+Y
Sbjct:    1 MPIRNIAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIAAAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFLLRFSTGGLATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVSWSWESQWVYWVGPLIGGGLAGVIYEVLFISHTHEQLPTTDY 250          
BLAST of CK933910 vs. ExPASy Swiss-Prot
Match: TIP12_ARATH (Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2 PE=1 SV=2)

HSP 1 Score: 366.696 bits (940), Expect = 9.755e-101
Identity = 183/253 (72.33%), Postives = 204/253 (80.63%), Query Frame = 2
Query:   77 MPIRNIAVGHPREAT-HPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQ-SHEQLPTTEY 829
            MP RNIA+G  +E   HP+ALRAALAEFISTLIFVFAG GSG+AFNK+T NGA TPS                     NISGGHVNPAVTFG  +GGNI+LLRGILYWIAQLLGS  AC LL F T G+   AF LS+GVG+ NA+VFEIVMTFGLVYTVYATA+DPK GSLGTIAPIAIGFIVGANILAGGAF GASMNPAV+FGPA+VSW+W NHWVYW GPLIGGGLAGI+Y+F FI++ +HEQLPTT+Y
Sbjct:    1 MPTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLVAAALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLIGGGLAGIIYDFVFIDENAHEQLPTTDY 253          
BLAST of CK933910 vs. ExPASy Swiss-Prot
Match: TIP11_MAIZE (Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 4.098e-99
Identity = 178/251 (70.92%), Postives = 197/251 (78.49%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 829
            MPI  IA+G  +E  HP AL+AA AEFISTLIFVFAG+GSGMAF+KLT  G  TP+                     NISGGHVNPAVTFGAFVGGNI+L RG+LYW+AQLLGSTVAC LL+F T GQ T  F L+ GV  W A+V EIVMTFGLVYTVYATA+DPKKGSLGTIAPIAIGFIVGANIL GGAFDGASMNPAVSFGPALVSW W   WVYWVGPLIGGGLAG++YE  FI+ +HEQLP+T+Y
Sbjct:    1 MPINRIALGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGPTTPAGLIAAAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFLLRFSTGGQATGTFGLT-GVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFISHTHEQLPSTDY 250          
BLAST of CK933910 vs. ExPASy Swiss-Prot
Match: TIP1_MEDTR (Probable aquaporin TIP-type OS=Medicago truncatula GN=AQP1 PE=1 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 2.034e-98
Identity = 181/251 (72.11%), Postives = 200/251 (79.68%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 829
            MPIRNIAVG P+EATHPD L+A LAEFIST IFVFAG GSG+A+NKLT++GA TP+                     NISGGHVNPAVTFGAFVGGNI+LLRGI+Y IAQLLGS VA  LL FVT   +  AF LS GVG   A+V EIVMTFGLVYTVYATA+DPKKG++G IAPIAIGFIVGANIL GGAF GASMNPAVSFGPA+VSWSW NHWVYW GPLIGGG+AG+VYE  FIN +HEQLPTT+Y
Sbjct:    1 MPIRNIAVGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTNDGAATPAGLISASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIVYIIAQLLGSIVASALLVFVT-ASSVPAFGLSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPAVVSWSWSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQLPTTDY 250          
BLAST of CK933910 vs. ExPASy Swiss-Prot
Match: TIP12_ORYSJ (Probable aquaporin TIP1-2 OS=Oryza sativa subsp. japonica GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 6.543e-97
Identity = 172/252 (68.25%), Postives = 195/252 (77.38%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQ-SHEQLPTTEY 829
            MP+  IAVG P E +HPD  +AA+AEFIS LIFVFAG GSGMAF+KLT  G  TPS                     NISGGHVNPAVTFGAFVGGNISL++ ++YW+AQLLGS VACLLLK  T G    AF+LS+GVGAWNAVVFEIVMTFGLVYTVYATA+DPKKG LG IAPIAIGFIVGANILAGGAFDGASMNPAVSFGPA+V+  WDNHWVYW+GP +G  +A ++Y+  FI Q  H+QLPT +Y
Sbjct:    1 MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGGTTPSGLIAASLAHALALFVAVAVGANISGGHVNPAVTFGAFVGGNISLVKAVVYWVAQLLGSVVACLLLKIATGGAAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVTGVWDNHWVYWLGPFVGAAIAALIYDIIFIGQRPHDQLPTADY 252          
BLAST of CK933910 vs. ExPASy Swiss-Prot
Match: TIP1_MEDSA (Probable aquaporin TIP-type OS=Medicago sativa GN=MCP1 PE=2 SV=2)

HSP 1 Score: 350.903 bits (899), Expect = 5.539e-96
Identity = 179/251 (71.31%), Postives = 198/251 (78.88%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLPTTEY 829
            MPIRNIAVG P+EATHPD L+A LAEFIST IFVFAG GSG+A+NKLT++GA TP+                     NISGGHVNPAV FGAFVGGNI+LLRGI+Y IAQLLGS V   LL FVT   +  AF LS GVG   A+V EIVMTFGLVYTVYATA+DPKKG++G IAPIAIGFIVGANIL GGAF GASMNPAVSFGPA+VSWSW NHWVYW GPLIGGG+AG+VYE  FIN +HEQLPTT+Y
Sbjct:    1 MPIRNIAVGTPQEATHPDTLKAGLAEFISTFIFVFAGSGSGIAYNKLTNDGAATPAGLISASIAHAFALFVAVSVGANISGGHVNPAV-FGAFVGGNITLLRGIVYIIAQLLGSIVCSALLVFVT-ASSVPAFGLSEGVGVGPALVLEIVMTFGLVYTVYATAVDPKKGNIGIIAPIAIGFIVGANILVGGAFTGASMNPAVSFGPAVVSWSWSNHWVYWAGPLIGGGIAGLVYEVLFINSTHEQLPTTDY 249          
BLAST of CK933910 vs. ExPASy Swiss-Prot
Match: TIP12_MAIZE (Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.045e-94
Identity = 173/250 (69.20%), Postives = 194/250 (77.60%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQ-SHEQLPTT 823
            MP+  IAVG P E +HPD  +AA+AEFISTLIFVFAG GSGMAF+KLT  GA TP+                     NISGGHVNPAVTFGAFVGGNISLL+ ++YW+AQLLGS VACLLLK  T G    AF+LS+GVGA NAVV E+VMTFGLVYTVYATA+DPKKG LG IAPIAIGFIVGANILAGGAFDGASMNPAVSFGPA+V+  W+NHWVYWVGPL G  +A +VY+  FI Q  H+QLPTT
Sbjct:    1 MPVSRIAVGAPGELSHPDTAKAAVAEFISTLIFVFAGSGSGMAFSKLTDGGAATPAGLIAASLAHALALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKALVYWVAQLLGSVVACLLLKIATGGAALGAFSLSAGVGAMNAVVLEMVMTFGLVYTVYATAVDPKKGDLGVIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPAVVTGVWENHWVYWVGPLAGAAIAALVYDIIFIGQRPHQQLPTT 250          
BLAST of CK933910 vs. ExPASy Swiss-Prot
Match: TIP13_ARATH (Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3 PE=1 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 4.389e-93
Identity = 168/252 (66.67%), Postives = 192/252 (76.19%), Query Frame = 2
Query:   77 MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFI-NQSHEQLPTTEY 829
            MPI  IA+G P EA+ PDA+RAA AEF S +IFVFAG+GSGMA+ KLT +G  TP+                     N+SGGHVNPAVTFGAF+GGNI+LLR ILYWIAQLLG+ VACLLLK  T G  T+AF+LS GV  WNAVVFEIVMTFGLVYTVYATA+DPKKG +G IAP+AIG IVGANIL GGAFDGASMNPAVSFGPA+VSW W NHWVYWVGP IG  +A IVY+  FI +  HE LP+ ++
Sbjct:    1 MPINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPAGLVAASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMNPAVSFGPAVVSWIWTNHWVYWVGPFIGAAIAAIVYDTIFIGSNGHEPLPSNDF 252          
BLAST of CK933910 vs. ExPASy Swiss-Prot
Match: TIP31_MAIZE (Aquaporin TIP3-1 OS=Zea mays GN=TIP3-1 PE=2 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 1.676e-76
Identity = 135/248 (54.44%), Postives = 171/248 (68.95%), Query Frame = 2
Query:   74 IMPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSXXXXXXXXXXXXXXXXXXXXXNISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATALDPKKGSLGTIAPIAIGFIVGANILAGGAFDGASMNPAVSFGPALVSWSWDNHWVYWVGPLIGGGLAGIVYEFFFINQSHEQLP 817
            + P R   VG   +ATHPD +RAA++EFI+T IFVFA EGS ++  K+ H+  +T                       NISGGHVNPAVTFGA VGG +SL+R +LYW+AQLLG+  A LLL+  T G     FAL+SGVG W+AV+ E VMTFGL+Y  YAT +DPK+G +GTIAP+A+GF++GAN+LAGG FDGA MNPA  FGPALV W W +HWVYW+GP +G GLAG+VYE+  I  +   +P
Sbjct:    5 VRPGRRFTVGRSEDATHPDTIRAAISEFIATAIFVFAAEGSVLSLGKMYHD-MSTAGGLVAVALAHALALAVAVAVAVNISGGHVNPAVTFGALVGGRVSLVRAVLYWVAQLLGAVAATLLLRLATGGMRPPGFALASGVGDWHAVLLEAVMTFGLMYAYYATVIDPKRGHVGTIAPLAVGFLLGANVLAGGPFDGAGMNPARVFGPALVGWRWRHHWVYWLGPFLGAGLAGLVYEYLVIPSADAAVP 251          
The following BLAST results are available for this feature:
BLAST of CK933910 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 193
Match NameE-valueIdentityDescription
TIP11_ARATH1.076e-10775.70Aquaporin TIP1-1 OS=Arabidopsis thaliana GN=TIP1-1... [more]
TIP11_ORYSJ1.361e-10273.71Probable aquaporin TIP1-1 OS=Oryza sativa subsp. j... [more]
TIP12_ARATH9.755e-10172.33Aquaporin TIP1-2 OS=Arabidopsis thaliana GN=TIP1-2... [more]
TIP11_MAIZE4.098e-9970.92Aquaporin TIP1-1 OS=Zea mays GN=TIP1-1 PE=2 SV=1[more]
TIP1_MEDTR2.034e-9872.11Probable aquaporin TIP-type OS=Medicago truncatula... [more]
TIP12_ORYSJ6.543e-9768.25Probable aquaporin TIP1-2 OS=Oryza sativa subsp. j... [more]
TIP1_MEDSA5.539e-9671.31Probable aquaporin TIP-type OS=Medicago sativa GN=... [more]
TIP12_MAIZE1.045e-9469.20Aquaporin TIP1-2 OS=Zea mays GN=TIP1-2 PE=2 SV=1[more]
TIP13_ARATH4.389e-9366.67Aquaporin TIP1-3 OS=Arabidopsis thaliana GN=TIP1-3... [more]
TIP31_MAIZE1.676e-7654.44Aquaporin TIP3-1 OS=Zea mays GN=TIP3-1 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G08 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933910 ID=CK933910|Name=CK933910|organism=Citrus sinensis|type=EST|length=879bp
GGGGAGACCAGTACACTTACGTGAACCAGTAGTAATCACACCCCAAAGGT
TCAATCTTCATCGTTTGTTCTCCATCATGCCGATCAGAAACATTGCCGTT
GGCCATCCCCGTGAGGCGACTCACCCAGATGCCCTAAGGGCAGCCCTAGC
AGAGTTCATCTCAACTCTAATATTTGTCTTTGCCGGTGAAGGCTCGGGCA
TGGCCTTCAACAAGCTCACTCACAACGGCGCCAATACCCCCTCCGGCCTC
GTCGCCGCCTCTGTTGCTCACGCTTTCGCCCTTTTCGTTGCTGTCGCCGT
TGGCGCCAACATTTCCGGTGGCCACGTTAATCCTGCTGTCACCTTTGGCG
CCTTCGTTGGAGGTAACATCTCCCTTCTACGTGGCATCCTCTACTGGATC
GCCCAGCTTCTTGGATCCACCGTCGCATGCTTGCTTCTTAAGTTCGTTAC
CAACGGCCAGACCACATCTGCTTTTGCTCTCTCATCTGGAGTTGGTGCAT
GGAACGCAGTCGTTTTCGAGATCGTGATGACATTCGGACTAGTGTACACA
GTGTATGCCACAGCCCTGGACCCAAAGAAGGGAAGCTTGGGGACAATTGC
ACCAATTGCAATTGGTTTCATTGTAGGAGCCAACATCTTGGCGGGCGGGG
CGTTTGATGGAGCTTCAATGAACCCAGCAGTGTCATTCGGGCCAGCTTTG
GTGAGCTGGAGCTGGGACAACCACTGGGTCTACTGGGTCGGGCCACTCAT
CGGTGGTGGGCTAGCTGGCATCGTCTACGAGTTCTTCTTCATTAACCAGT
CGCATGAGCAGCTCCCAACAACCGAGTACTAAGCTAAAAGCTTGCCATCT
ATGTNAGTTTGCACGGATGTTGTATTTAA
back to top