CK933912

Overview
NameCK933912
Unique NameCK933912
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length585
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:443..1027. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933912 vs. ExPASy Swiss-Prot
Match: UBL5_ARATH (Ubiquitin-like protein 5 OS=Arabidopsis thaliana GN=UBL5 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.035e-35
Identity = 70/73 (95.89%), Postives = 73/73 (100.00%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYYS 276
            MIEVVLNDRLGKKVRVKCN+DDTIGDLKKLVAAQTGTRA+KIRIQKWYNIYKDHITLKDYEIHDGMGLELYY+
Sbjct:    1 MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRAEKIRIQKWYNIYKDHITLKDYEIHDGMGLELYYN 73          
BLAST of CK933912 vs. ExPASy Swiss-Prot
Match: UBL5_PSAOB (Ubiquitin-like protein 5 OS=Psammomys obesus GN=UBL5 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.845e-28
Identity = 58/72 (80.56%), Postives = 65/72 (90.28%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM LELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of CK933912 vs. ExPASy Swiss-Prot
Match: UBL5_MOUSE (Ubiquitin-like protein 5 OS=Mus musculus GN=Ubl5 PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.845e-28
Identity = 58/72 (80.56%), Postives = 65/72 (90.28%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM LELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of CK933912 vs. ExPASy Swiss-Prot
Match: UBL5_MESAU (Ubiquitin-like protein 5 OS=Mesocricetus auratus GN=UBL5 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.845e-28
Identity = 58/72 (80.56%), Postives = 65/72 (90.28%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM LELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of CK933912 vs. ExPASy Swiss-Prot
Match: UBL5_HUMAN (Ubiquitin-like protein 5 OS=Homo sapiens GN=UBL5 PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.845e-28
Identity = 58/72 (80.56%), Postives = 65/72 (90.28%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM LELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of CK933912 vs. ExPASy Swiss-Prot
Match: UBL5_BOVIN (Ubiquitin-like protein 5 OS=Bos taurus GN=UBL5 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.845e-28
Identity = 58/72 (80.56%), Postives = 65/72 (90.28%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM LELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of CK933912 vs. ExPASy Swiss-Prot
Match: UBL5_DANRE (Ubiquitin-like protein 5 OS=Danio rerio GN=ubl5 PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 7.010e-28
Identity = 56/72 (77.78%), Postives = 66/72 (91.67%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIEVV NDRLGKKVRVKCN++DTIGDLKKL+AAQTGTR +KI ++KWY I+K+H++L DYEIHDGM LELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNQEDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKNHVSLGDYEIHDGMNLELYY 72          
BLAST of CK933912 vs. ExPASy Swiss-Prot
Match: UBL5_CAEEL (Ubiquitin-like protein 5 OS=Caenorhabditis elegans GN=ubl-5 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.544e-27
Identity = 54/72 (75.00%), Postives = 62/72 (86.11%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIE+ +NDRLGKKVR+KCN  DTIGDLKKL+AAQTGTR +KI ++KWY IYKDHITL DYEIH+G   ELYY
Sbjct:    1 MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHITLMDYEIHEGFNFELYY 72          
BLAST of CK933912 vs. ExPASy Swiss-Prot
Match: UBL5_DROME (Ubiquitin-like protein 5 OS=Drosophila melanogaster GN=ubl PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.012e-26
Identity = 55/72 (76.39%), Postives = 62/72 (86.11%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYY 273
            MIE+  NDRLGKKVRVKCN DDTIGDLKKL+AAQTGT+ +KI ++KWY I+KD I L DYEIHDGM LELYY
Sbjct:    1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDGMNLELYY 72          
BLAST of CK933912 vs. ExPASy Swiss-Prot
Match: HUB1_SCHPO (Ubiquitin-like modifier hub1 OS=Schizosaccharomyces pombe GN=hub1 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 5.554e-25
Identity = 52/73 (71.23%), Postives = 63/73 (86.30%), Query Frame = 1
Query:   58 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGLELYYS 276
            MIEV+ NDRLGKKVRVKC  DDT+GD KKLVAAQTGT   +I ++KW++++KD+ITL DYEIHDGM LE+YYS
Sbjct:    1 MIEVLCNDRLGKKVRVKCMPDDTVGDFKKLVAAQTGTDPRRIVLKKWHSVFKDNITLADYEIHDGMSLEMYYS 73          
The following BLAST results are available for this feature:
BLAST of CK933912 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
UBL5_ARATH2.035e-3595.89Ubiquitin-like protein 5 OS=Arabidopsis thaliana G... [more]
UBL5_PSAOB1.845e-2880.56Ubiquitin-like protein 5 OS=Psammomys obesus GN=UB... [more]
UBL5_MOUSE1.845e-2880.56Ubiquitin-like protein 5 OS=Mus musculus GN=Ubl5 P... [more]
UBL5_MESAU1.845e-2880.56Ubiquitin-like protein 5 OS=Mesocricetus auratus G... [more]
UBL5_HUMAN1.845e-2880.56Ubiquitin-like protein 5 OS=Homo sapiens GN=UBL5 P... [more]
UBL5_BOVIN1.845e-2880.56Ubiquitin-like protein 5 OS=Bos taurus GN=UBL5 PE=... [more]
UBL5_DANRE7.010e-2877.78Ubiquitin-like protein 5 OS=Danio rerio GN=ubl5 PE... [more]
UBL5_CAEEL4.544e-2775.00Ubiquitin-like protein 5 OS=Caenorhabditis elegans... [more]
UBL5_DROME1.012e-2676.39Ubiquitin-like protein 5 OS=Drosophila melanogaste... [more]
HUB1_SCHPO5.554e-2571.23Ubiquitin-like modifier hub1 OS=Schizosaccharomyce... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G11 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933912 ID=CK933912|Name=CK933912|organism=Citrus sinensis|type=EST|length=585bp
GGGGAAACGAGAAAATCCCAAATCATTCGGCGGGGAAAATCAAAACAGGA
GACAAAGATGATTGAGGTGGTGCTGAACGACAGGCTCGGGAAGAAGGTGC
GCGTGAAGTGCAACGAAGACGACACCATAGGCGACTTGAAGAAGCTGGTG
GCGGCTCAGACCGGGACTCGAGCCGACAAGATTCGGATTCAGAAGTGGTA
CAACATCTACAAGGACCACATCACTCTCAAGGACTACGAGATTCACGACG
GCATGGGCCTTGAACTCTATTACAGCTAAATCCACCGTTAAATATATATG
CTGCTGCAAGCAGTCAATACTACTAGGAACCATATGCTATAATAAGCAAG
GGGTATTGGAAGATGCGGCAGGGCCAACTTTACTAATACTGTCTTGTAAG
AAAAAATTTGTGAAGACTCGTAAAAACTTATTTGTGGTTATGTAACATAT
CTGGGATCTGGACTTACTCTCCATTTTGAATGGTGTTTAGATCTTTATCA
AGGTATTGAGGTACCACATGCTTGTCAGTCCATTAGGCTGATAGAATTTT
GTGAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top