CK933915

Overview
NameCK933915
Unique NameCK933915
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length834
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1296 contig Csv1_Contig1296:702..1534. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933915 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 4.416e-31
Identity = 75/199 (37.69%), Postives = 114/199 (57.29%), Query Frame = 3
Query:   57 ATTLSFLILALASNSLLVLGTSSVPEPLLDVNGNKVESTLQYYIVSAIWXXXXXXXXXXXXXXXYCPLDVIQLPSDTQNGIKLTLSPYNNST-IVRESTDLNLRFSVLLSGRD-YCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGR-SFEDGVRRLVL 644
            AT +  L+ A  S S      ++   P+LD +G+++++ +QYY++S+I                 CP  V+Q  SD  NG  +  S  ++   +VR STD+N+ F  +   RD  C+   +W++DNYD ++GKW++TT G+ G PG  TL +WFK+EK G     YK   CPSVC+SC  LC+++GR S +DG  RL L
Sbjct:    4 ATAVVLLLFAFTSKSYFFGVANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPI---RDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVL--GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLAL 197          
BLAST of CK933915 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 120.553 bits (301), Expect = 1.125e-26
Identity = 72/210 (34.29%), Postives = 108/210 (51.43%), Query Frame = 3
Query:   48 ISLATTLSFLILALASNSLLVLGTSSVPEPLLDVNGNKVESTLQYYIVSAI--WXXXXXXXXXXXXXXXYCPLDVIQLPSDTQNGIKLTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFEDGVRRLVLVRDDEPAF 668
            +SL+      +LA A+N LL     S P P+LD++G K+ +   YYIV  +                   CP  V+Q   +  +   L   P N    +VR STDLN+ FS  +  R       +W++D YD ++G++F+T GG+ G+PG ET+ +WFK+E+     G YK+V CP+VC SC   C +VG   +   RR + + D   AF
Sbjct:    7 LSLSFFFVSALLAAAANPLLS-AADSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCR--WTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCG-SGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAF 212          
BLAST of CK933915 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 7.066e-21
Identity = 65/179 (36.31%), Postives = 94/179 (52.51%), Query Frame = 3
Query:  129 PEPLLDVNGNKVESTLQYYIVSAIWXXXXXXXXXXXXXXXY-CPLDVIQLPSDTQNGIKLTLSPYNN--STIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFED-GVRRLVLVRD 653
            P+P++D++G  V   + Y++VSAIW                 CPL V+Q P D  NG  +  S   N    IV ES DLN++F++ ++    CNE   WKVD +    G W +T GG  G+ G E+  + FK++K G  P +YK   CPS   + +  CNNV   F+   +RRL+L  D
Sbjct:    3 PKPIVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQDPFD--NGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN----CNETTAWKVDRFPGVIG-WTVTLGGEKGYHGFESTHSMFKIKKAG-LPFSYKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTND 173          
BLAST of CK933915 vs. ExPASy Swiss-Prot
Match: DRTI_DELRE (Kunitz-type serine protease inhibitor DrTI OS=Delonix regia PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.427e-13
Identity = 57/185 (30.81%), Postives = 87/185 (47.03%), Query Frame = 3
Query:  132 EPLLDVNGNKVESTLQYYIVSAIWXXXXXXXXXXXXXXXYCPLDVIQLPSDTQNGIKLTLS-PYNNSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFEDGVRRLVLVRDDEPAFPVVLI 683
            E + D+ G  V    +YYIVSAI                 CP+ +IQ  SD Q G+ +  S P  +   +   T+L + F      +  C E   W +      SG+  +  GG + HP  E +  +FK+EK+G+    YK+V CP   +S    C+++G ++E G R LVL   D+  F VV +
Sbjct:    4 EKVYDIEGYPVFLGSEYYIVSAIIGAGGGGVRPGRTRGSMCPMSIIQEQSDLQMGLPVRFSSPEESQGKIYTDTELEIEFVE----KPDCAESSKWVIVK---DSGEARVAIGGSEDHPQGELVRGFFKIEKLGSL--AYKLVFCP---KSSSGSCSDIGINYE-GRRSLVLKSSDDSPFRVVFV 175          
BLAST of CK933915 vs. ExPASy Swiss-Prot
Match: SPORB_IPOBA (Sporamin B OS=Ipomoea batatas GN=GSPO-B1 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.578e-12
Identity = 59/193 (30.57%), Postives = 88/193 (45.60%), Query Frame = 3
Query:  117 TSSVPEPLLDVNGNKVESTLQYYIVSAIW--XXXXXXXXXXXXXXXYCPLDVIQLPSDTQNGIKLTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFEDGVRRLVLVRDDEPAFPVVLIP 686
            T+S   P+LD+NG++V +   YYIVSAIW                  C  DVI   SD  NG  +T++P +  +T+V  ST    RF++  +    C     W +  +D+ SG++F+  G            N FK+E + +    YKI +C    E C     NVGR ++   R   L   + P F  V+ P
Sbjct:   34 TASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNI--ATNKLCVNNVNWGI-KHDSESGQYFVKAGEF-----VSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCF----NVGRYYDPLTRATRLALSNTP-FVFVIKP 213          
BLAST of CK933915 vs. ExPASy Swiss-Prot
Match: SPOR1_IPOBA (Sporamin A OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.515e-12
Identity = 57/193 (29.53%), Postives = 88/193 (45.60%), Query Frame = 3
Query:  120 SSVPEPLLDVNGNKVESTLQYYIVSAIW-XXXXXXXXXXXXXXXYCPLDVIQLPSDTQNGIKLTLSPYN---NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFEDGVRRLVLVRDDEPAFPVVLIP 686
            +S   P+LD+NG++V +   YY+VSAIW                 C  DVI  P+D  NG  +T++P      ST+V  ST    RF++  +    C     W +  +D+ASG++F+  G            N FK+E +     +YK+ +C    + C     NVGR  +  +R   L   + P F  V+ P
Sbjct:   37 ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLDMMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNI--ATNKLCVNNVNWGI-QHDSASGQYFLKAGEF-----VSDNSNQFKIELVDANLNSYKLTYCQFGSDKCY----NVGRFHDHMLRTTRLALSNSP-FVFVIKP 216          
BLAST of CK933915 vs. ExPASy Swiss-Prot
Match: SPOR2_IPOBA (Sporamin B OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.996e-12
Identity = 58/193 (30.05%), Postives = 88/193 (45.60%), Query Frame = 3
Query:  117 TSSVPEPLLDVNGNKVESTLQYYIVSAIW--XXXXXXXXXXXXXXXYCPLDVIQLPSDTQNGIKLTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFEDGVRRLVLVRDDEPAFPVVLIP 686
            T+S   P+LD+NG++V +   YY+VSAIW                  C  DVI   SD  NG  +T++P +  +T+V  ST    RF++  +    C     W +  +D+ SG++F+  G            N FK+E + +    YKI +C    E C     NVGR ++   R   L   + P F  V+ P
Sbjct:   34 TASSETPVLDINGDEVRAGENYYMVSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNI--ATNKLCVNNVNWGI-KHDSESGQYFVKAGEF-----VSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCF----NVGRYYDPLTRATRLALSNIP-FVFVIKP 213          
BLAST of CK933915 vs. ExPASy Swiss-Prot
Match: SPI2_SOLTU (Serine protease inhibitor 2 OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.278e-11
Identity = 49/179 (27.37%), Postives = 82/179 (45.81%), Query Frame = 3
Query:  135 PLLDVNGNKVESTLQYYIVSAIWXXXXXXXXXXXXXXXYCPL--DVIQLPSD---TQNGIKLTLSPYNNSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFEDGVRRLVLVRDD 656
            P+LDV G +++S L Y I+S  W                 P    + +  SD   +   ++   S  +    + E+  LN++F++  S    C    +WKV +YDA+ G   + TGG  G   +    +WFK+ K       Y +++CP    S  + C+ VG   ++G RRL LV ++
Sbjct:    7 PVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTS--KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADS----SWFKIVKSSQLG--YNLLYCPVTSSSDDQFCSKVGVVHQNGKRRLALVNEN 177          
The following BLAST results are available for this feature:
BLAST of CK933915 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
ASP_THECC4.416e-3137.6921 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU1.125e-2634.29Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA7.066e-2136.31Latex serine proteinase inhibitor OS=Carica papaya... [more]
DRTI_DELRE1.427e-1330.81Kunitz-type serine protease inhibitor DrTI OS=Delo... [more]
SPORB_IPOBA1.578e-1230.57Sporamin B OS=Ipomoea batatas GN=GSPO-B1 PE=2 SV=1[more]
SPOR1_IPOBA3.515e-1229.53Sporamin A OS=Ipomoea batatas PE=2 SV=1[more]
SPOR2_IPOBA5.996e-1230.05Sporamin B OS=Ipomoea batatas PE=2 SV=1[more]
SPI2_SOLTU2.278e-1127.37Serine protease inhibitor 2 OS=Solanum tuberosum P... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_F06 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_F06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933915 ID=CK933915|Name=CK933915|organism=Citrus sinensis|type=EST|length=834bp
GGGGGCGCATCAAACAGATATATAGCTTTGAAAACAACAAAATGAAGATT
TCATTAGCAACAACACTCTCTTTCCTTATCCTTGCCTTGGCCTCAAACTC
TTTGTTGGTCTTGGGCACCTCATCAGTTCCTGAACCTCTCCTTGATGTCA
ACGGCAACAAGGTCGAATCCACCCTTCAGTACTACATAGTCTCAGCCATC
TGGGGAGCTGGCGGTGGTGGAGTTAGCCTACACGGTGGCAGAAACGGATA
TTGTCCGCTGGACGTTATCCAATTACCTTCTGATACGCAAAATGGAATCA
AATTAACACTGTCACCGTATAACAATTCTACAATTGTCCGAGAATCCACT
GATCTCAACTTGAGATTCTCAGTGTTGCTATCTGGACGTGACTATTGTAA
CGAACAACCGTTGTGGAAAGTTGATAATTATGACGCGGCATCAGGCAAAT
GGTTTATAACAACCGGGGGACTTGATGGTCACCCTGGAGCTGAAACTTTG
CTAAATTGGTTTAAGCTTGAGAAAATTGGAAATTTTCCAGGTACATACAA
AATCGTTCATTGTCCATCCGTTTGCGAGTCTTGTGTCAAACTCTGCAACA
ACGTTGGCCGTTCGTTTGAGGATGGCGTTCGACGTCTGGTTCTGGTTCGT
GATGATGAGCCGGCATTTCCTGTTGTGTTAATTCCCGCTACAGAAAGATC
AACGTCTGTGTAATCAATGTACCCTAACCAGCTAGCGGTATTATTATTCT
AAATAACGGACCANGCTAGCTGCTCTTTTATCTCTAGGATTAAAATNNNG
AATAAGAAACCCNGTGATCCTTTCAGNNNTNATA
back to top