CK933916

Overview
NameCK933916
Unique NameCK933916
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length837
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12923 contig Csv1_Contig12923:1..829. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933916 vs. ExPASy Swiss-Prot
Match: CHI2_BRANA (Endochitinase CH25 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.362e-80
Identity = 136/224 (60.71%), Postives = 168/224 (75.00%), Query Frame = 3
Query:  177 ELGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 836
            +L  IISR  FDD+L++RND  CPARGFYTYDAFI AA++FPGFG +G+   RK+EIAAFF QT HETTGGW  AP G Y+WGYCF  E +P S+YC P+  +PC     YYGRGP+QLSWNYNY +C           NNPDL++ DPV++FK+AIWFWMT Q PKPSCH VI+ +W+PS  D  AGR+PGYG+ TNIINGG+ECG+G +A V +RIGF+  +
Sbjct:   70 DLSGIISRSQFDDMLKHRNDNACPARGFYTYDAFINAAKSFPGFGTTGDTATRKKEIAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPSSNYCSPSAEWPCASGKSYYGRGPMQLSWNYNYGQC--GRAIGSDLLNNPDLVSNDPVIAFKAAIWFWMTPQSPKPSCHAVIVGQWQPSDADRAAGRVPGYGVITNIINGGLECGRGQDARVADRIGFYQRY 291          
BLAST of CK933916 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 3.963e-80
Identity = 136/221 (61.54%), Postives = 166/221 (75.11%), Query Frame = 3
Query:  186 KIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYC--DPNYPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 836
            KIISR MFD +L++RN+  CPA+GFYTYDAF+ AA++FP FG +G+  +RKRE+AAF  QT HETTGGWP AP G YAWGYCF+ E +P S+YC   P YPC  GK YYGRGP+QLSWNYNY  C            NPDL+ATD VLSFK+A+WFWMT Q PKPSCH+V+   W+PSA D  AGRLPGYG+ TN++NGG+ECG+G N  V +R+GFF  +
Sbjct:    4 KIISRSMFDQMLKHRNNPACPAKGFYTYDAFLAAAKSFPSFGTTGSTDVRKRELAAFLGQTSHETTGGWPSAPDGPYAWGYCFLKERNPSSNYCAPSPRYPCAPGKSYYGRGPLQLSWNYNYGPC--GEALRVNLLGNPDLVATDRVLSFKTALWFWMTPQAPKPSCHDVLTGRWQPSAADTAAGRLPGYGVLTNLLNGGLECGKGPNPQVADRLGFFRRY 222          
BLAST of CK933916 vs. ExPASy Swiss-Prot
Match: CHIB_ARATH (Basic endochitinase B OS=Arabidopsis thaliana GN=CHI-B PE=1 SV=3)

HSP 1 Score: 297.745 bits (761), Expect = 5.176e-80
Identity = 136/224 (60.71%), Postives = 167/224 (74.55%), Query Frame = 3
Query:  177 ELGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 836
            +L  IIS   FDD+L++RND  CPARGFYTY+AFI AA++FPGFG +G+   RK+E+AAFF QT HETTGGW  AP G Y+WGYCF  E +P SDYC+P+  +PC    +YYGRGP+QLSWNYNY  C           NNPDL+A D V++FK+AIWFWMTAQPPKPSCH VI  +W+PS  D  AGRLPGYG+ TNIINGG+ECG+G +  V +RIGF+  +
Sbjct:   85 DLSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPASDYCEPSATWPCASGKRYYGRGPMQLSWNYNYGLC--GRAIGVDLLNNPDLVANDAVIAFKAAIWFWMTAQPPKPSCHAVIAGQWQPSDADRAAGRLPGYGVITNIINGGLECGRGQDGRVADRIGFYQRY 306          
BLAST of CK933916 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 296.204 bits (757), Expect = 1.506e-79
Identity = 137/224 (61.16%), Postives = 168/224 (75.00%), Query Frame = 3
Query:  177 ELGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCR--GKYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 836
            +LG IIS  MFD +L++RND  C  +GFY+Y+AFI AA++FPGFG SG+ T RKREIAAFFAQT HETTGGW  AP G YAWGYC++ E   P DYC P+  +PC    KY+GRGPIQ+S NYNY  C           NNPDL+ATDPV+SFKSA+WFWMT Q PKPSCH+VII  W+PSA D  A RLPG+G+ TNIINGG+ECG+G ++ V++RIGF+  +
Sbjct:   79 DLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPC--GRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSAGDRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRY 300          
BLAST of CK933916 vs. ExPASy Swiss-Prot
Match: CHI2_TOBAC (Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 5.722e-79
Identity = 136/224 (60.71%), Postives = 168/224 (75.00%), Query Frame = 3
Query:  177 ELGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCR--GKYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 836
            +LG IIS  MFD +L++RND  C  +GFY+Y+AFI AA++FPGFG SG+ T RKREIAAFFAQT HETTGGW  AP G YAWGYC++ E   P DYC P+  +PC    KY+GRGPIQ+S NYNY  C           NNPDL+ATDPV+SFKSA+WFWMT Q PKPSCH+VII  W+PS+ D  A RLPG+G+ TNIINGG+ECG+G ++ V++RIGF+  +
Sbjct:   74 DLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPC--GRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSSADRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRY 295          
BLAST of CK933916 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 1.275e-78
Identity = 141/225 (62.67%), Postives = 168/225 (74.67%), Query Frame = 3
Query:  180 LGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGG--WPDAPGGEYAWGYCFISEVSPPSDYC--DPNYPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 836
            L  +ISRE F+ +L +RND  CPARGFYTYDAFI AA++FP F  +G++  RKREIAAF AQT HETTGG  W  AP G YAWGYC+  E++PPS YC  DPNYPC  GK Y+GRGP+QLSWNYNY +C           NNPDLL++DP +SFKSA WFWMT Q PKPSCH VII  W PS++D  AGR+PGYG+ TNIINGG+ECG+G NA V +RIGF+  +
Sbjct:   74 LTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSSYCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLL--NNPDLLSSDPTISFKSAFWFWMTPQSPKPSCHNVIIGAWSPSSSDRAAGRVPGYGVITNIINGGLECGKGWNAQVEDRIGFYKRY 295          
BLAST of CK933916 vs. ExPASy Swiss-Prot
Match: CHI4_SOLTU (Endochitinase 4 (Fragment) OS=Solanum tuberosum GN=CHTB4 PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 1.409e-77
Identity = 135/225 (60.00%), Postives = 167/225 (74.22%), Query Frame = 3
Query:  177 ELGKIISREMFDDLLEYRNDERCPARG-FYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 836
            ++G +IS  MFD +L++RND  C  +  FY+Y+AFI AA++F GFG +G+ T RKREIAAFFAQT HETTGGWP AP G YAWGYCF+ E   P DYC P+  +PC    KY+GRGPIQ+S NYNY  C           NNPDL+ATDPV+SFKSAIWFWMT Q PKPSCH+VII  W+PSA D  A RLPG+G+ TNIINGG+ECG+G ++ V++RIGF+  +
Sbjct:   77 DIGSVISNSMFDQMLKHRNDNACQGKNNFYSYNAFINAARSFGGFGTTGDTTARKREIAAFFAQTSHETTGGWPTAPDGPYAWGYCFLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLL--NNPDLVATDPVISFKSAIWFWMTPQSPKPSCHDVIIGRWQPSAADRAANRLPGFGVITNIINGGLECGRGSDSRVQDRIGFYRRY 299          
BLAST of CK933916 vs. ExPASy Swiss-Prot
Match: CHI2_GOSHI (Endochitinase 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=2)

HSP 1 Score: 289.271 bits (739), Expect = 1.841e-77
Identity = 140/225 (62.22%), Postives = 166/225 (73.78%), Query Frame = 3
Query:  180 LGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGG--WPDAPGGEYAWGYCFISEVSPPSDYC--DPNYPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 836
            L  +ISRE F+ +L +RND  CPARGFYTYDAFI AA++FP F  +G++  RKREIAAF AQT HETTGG  W  AP G YAWGYC+  E++PPS YC  DPNYPC  GK Y+GRGP+QLSWNYNY +C           NNPDLL++DP +SFKSA WFWMT Q PKPSCH VII  W PS++D  AGR  GYG+ TNIINGG+ECG+G NA V +RIGF+  +
Sbjct:   52 LTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSSYCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLL--NNPDLLSSDPTISFKSAFWFWMTPQSPKPSCHNVIIGAWSPSSSDRAAGRATGYGVITNIINGGLECGKGWNAQVEDRIGFYKRY 273          
BLAST of CK933916 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 1.841e-77
Identity = 140/225 (62.22%), Postives = 167/225 (74.22%), Query Frame = 3
Query:  180 LGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGG--WPDAPGGEYAWGYCFISEVSPPSDYC--DPNYPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 836
            L  +I+RE FD +L +RND  CPARGFYTYDAFI AA++FP F  +G++  RKRE+AAF AQT HETTGG  W  AP G Y WGYC+  E++P +DYC  DPNYPC  GK Y+GRGP+QL+WNYNY +C           NNPDLLATDP +SFKSA WFWMT Q PKPSCH+VII  W PS +D  AGR+PG+GL TNIINGG+ECGQG NA V +RIGF+  +
Sbjct:   72 LDSLITRERFDQMLLHRNDGGCPARGFYTYDAFIAAAKSFPAFATTGDDATRKREVAAFLAQTSHETTGGAGWA-APDGPYTWGYCYNRELNP-ADYCQWDPNYPCAPGKQYFGRGPMQLTWNYNYGQCGRAIGVDLL--NNPDLLATDPTISFKSAFWFWMTPQSPKPSCHDVIIGAWSPSGSDQAAGRVPGFGLITNIINGGLECGQGWNAKVEDRIGFYKRY 292          
BLAST of CK933916 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 2.404e-77
Identity = 136/224 (60.71%), Postives = 164/224 (73.21%), Query Frame = 3
Query:  177 ELGKIISREMFDDLLEYRNDERCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGHETTGGWPDAPGGEYAWGYCFISEVSPPSDYCD--PNYPCR--GKYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTF 836
            +L  +ISR  FD +L++RND  CPA+GFYTYDAFI AA+A+P FGN+G+   RKREIAAF  QT HETTGGW  AP G YAWGYCF+ E + PS YC   P +PC    +YYGRGPIQ+SWNYNY +C           N PDL+ATD V+SFKSA+WFWMTAQ PKPS H+VI   W PS+ DV A RLPGYG  TNIINGG+ECG+G ++ V++RIGFF  +
Sbjct:   75 DLSALISRSTFDQMLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERN-PSTYCSATPQFPCAPGQQYYGRGPIQISWNYNYGQC--GRAIGVDLLNKPDLVATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFFKRY 295          
The following BLAST results are available for this feature:
BLAST of CK933916 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHI2_BRANA1.362e-8060.71Endochitinase CH25 OS=Brassica napus PE=2 SV=1[more]
CHIT_CARPA3.963e-8061.54Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHIB_ARATH5.176e-8060.71Basic endochitinase B OS=Arabidopsis thaliana GN=C... [more]
CHI1_TOBAC1.506e-7961.16Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]
CHI2_TOBAC5.722e-7960.71Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1... [more]
CHI1_GOSHI1.275e-7862.67Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHI4_SOLTU1.409e-7760.00Endochitinase 4 (Fragment) OS=Solanum tuberosum GN... [more]
CHI2_GOSHI1.841e-7762.22Endochitinase 2 (Fragment) OS=Gossypium hirsutum P... [more]
CHI1_THECC1.841e-7762.22Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHIT_PHAVU2.404e-7760.71Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_F08 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_F08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933916 ID=CK933916|Name=CK933916|organism=Citrus sinensis|type=EST|length=837bp
GGGACACCAAGCAGAGGATAATTGATATCATAACTGTTGCTTTCAAAATG
AGGCTTATTGGGTCCTTACTAATTTTCTCTCTAGTTTTATCTTTTGTACT
AGGAGGCTCAGCACAGAACTGTGGAAGCGGCGTTGTGTACGGTGGACGTG
ATACCGGCCATGGGACGCATGGCGGTGAACTGGGCAAGATCATCTCAAGG
GAGATGTTTGATGACTTGCTTGAGTATAGAAATGATGAACGATGCCCTGC
CAGAGGCTTCTACACTTATGATGCTTTTATAGAGGCAGCCCAAGCTTTTC
CAGGCTTTGGTAACTCTGGAAATGAAACCATGCGTAAAAGAGAAATCGCT
GCCTTTTTTGCCCAAACTGGCCATGAAACTACTGGGGGATGGCCCGATGC
ACCTGGTGGCGAATATGCTTGGGGATATTGCTTTATAAGCGAAGTTAGCC
CTCCGTCCGACTACTGTGATCCTAACTATCCATGTCGAGGGAAGTACTAT
GGCCGAGGTCCAATTCAACTCTCTTGGAATTACAATTACTTACGGTGCGG
AGAAGGCCTAGGGCTAGGAGAGGAGTTGTTGAACAATCCAGACCTTCTTG
CTACTGATCCAGTACTATCATTCAAGTCAGCAATCTGGTTCTGGATGACT
GCACAGCCACCAAAGCCATCGTGCCACGAAGTCATTATCGACGAATGGAA
ACCATCAGCAAATGACGTAAACGCCGGCCGGCTTCCGGGATACGGTCTAA
CCACAAATATAATCAACGGTGGAATTGAATGTGGCCAAGGTGGGAATGCC
GCTGTACGTAACCGTATTGGGTTCTTTACCACTTTCT
back to top