CK934069

Overview
NameCK934069
Unique NameCK934069
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length910
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK934069 vs. ExPASy Swiss-Prot
Match: TMM85_XENLA (Transmembrane protein 85 OS=Xenopus laevis GN=tmem85 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 7.115e-17
Identity = 56/180 (31.11%), Postives = 88/180 (48.89%), Query Frame = 2
Query:   41 VMGSGRR--WAVDFTDNSTTP-----STRDIADPPGFSRASQDQDDSTLSRQKKDAEANWKSQKAWEVAQAPFKNLXXXXXXXXXAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKDSKVDLLGPKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPALEVEYSGGGIPL 559
            V   GRR  WA++F    +         +D   P G+S      D        ++++     ++ W++A  P K +         AG+T+ +F I +     W+PI AL      F+  + S    L   L+++  NL GLALGV+K  ++GLLPTHASDW++ + P   +EY+GGG  L
Sbjct:    8 VTNRGRRFKWAIEFGSGGSRGRGERGGLQDSMYPVGYS------DKQVPDTSVQESDHILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPIMMVCMMAWRPIQALLATPATFKLLESSGQRFL-QGLVYLIGNLLGLALGVYKCQSMGLLPTHASDWLAFIEPPERMEYTGGGFLL 180          
BLAST of CK934069 vs. ExPASy Swiss-Prot
Match: TMM85_BOVIN (Transmembrane protein 85 OS=Bos taurus GN=TMEM85 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 9.293e-17
Identity = 60/193 (31.09%), Postives = 91/193 (47.15%), Query Frame = 2
Query:   29 KGKGVMGSGRR--WAVDFTDNSTTPSTRDIADPPGFSRASQD----QDDST-----LSRQKKDAEANWKSQ-----KAWEVAQAPFKNLXXXXXXXXXAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKDSKVDLLGPKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPALEVEYSGGGIPL 559
            +G  V   GRR  WA++            ++ P G SR   D    Q DS      L +Q  D       +     + W++A  P K +         AG+T+ +F   +     W+PI AL  +   F+  + S    L   L+++  NL GLAL V+K  ++GLLPTHASDW++ + P   +E+SGGG+ L
Sbjct:    4 QGSLVANRGRRFKWAIE------------LSGPGGGSRGRSDRGGGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFL-QGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL 183          
BLAST of CK934069 vs. ExPASy Swiss-Prot
Match: TMM85_PONAB (Transmembrane protein 85 OS=Pongo abelii GN=TMEM85 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.585e-16
Identity = 60/193 (31.09%), Postives = 91/193 (47.15%), Query Frame = 2
Query:   29 KGKGVMGSGRR--WAVDFTDNSTTPSTRDIADPPGFSRASQD----QDDST-----LSRQKKDAEANWKSQ-----KAWEVAQAPFKNLXXXXXXXXXAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKDSKVDLLGPKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPALEVEYSGGGIPL 559
            +G  V   GRR  WA++            ++ P G SR   D    Q DS      L +Q  D       +     + W++A  P K +         AG+T+ +F   +     W+PI AL  +   F+  + S    L   L+++  NL GLAL V+K  ++GLLPTHASDW++ + P   +E+SGGG+ L
Sbjct:    4 QGGLVANRGRRFKWAIE------------LSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFL-QGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL 183          
BLAST of CK934069 vs. ExPASy Swiss-Prot
Match: TMM85_MOUSE (Transmembrane protein 85 OS=Mus musculus GN=Tmem85 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.585e-16
Identity = 60/193 (31.09%), Postives = 91/193 (47.15%), Query Frame = 2
Query:   29 KGKGVMGSGRR--WAVDFTDNSTTPSTRDIADPPGFSRASQD----QDDST-----LSRQKKDAEANWKSQ-----KAWEVAQAPFKNLXXXXXXXXXAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKDSKVDLLGPKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPALEVEYSGGGIPL 559
            +G  V   GRR  WA++            ++ P G SR   D    Q DS      L +Q  D       +     + W++A  P K +         AG+T+ +F   +     W+PI AL  +   F+  + S    L   L+++  NL GLAL V+K  ++GLLPTHASDW++ + P   +E+SGGG+ L
Sbjct:    4 QGGLVANRGRRFKWAIE------------LSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFL-QGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL 183          
BLAST of CK934069 vs. ExPASy Swiss-Prot
Match: TMM85_HUMAN (Transmembrane protein 85 OS=Homo sapiens GN=TMEM85 PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 1.585e-16
Identity = 60/193 (31.09%), Postives = 91/193 (47.15%), Query Frame = 2
Query:   29 KGKGVMGSGRR--WAVDFTDNSTTPSTRDIADPPGFSRASQD----QDDST-----LSRQKKDAEANWKSQ-----KAWEVAQAPFKNLXXXXXXXXXAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKDSKVDLLGPKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPALEVEYSGGGIPL 559
            +G  V   GRR  WA++            ++ P G SR   D    Q DS      L +Q  D       +     + W++A  P K +         AG+T+ +F   +     W+PI AL  +   F+  + S    L   L+++  NL GLAL V+K  ++GLLPTHASDW++ + P   +E+SGGG+ L
Sbjct:    4 QGGLVANRGRRFKWAIE------------LSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFL-QGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL 183          
BLAST of CK934069 vs. ExPASy Swiss-Prot
Match: TMM85_DANRE (Transmembrane protein 85 OS=Danio rerio GN=tmem85 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.585e-16
Identity = 52/171 (30.41%), Postives = 87/171 (50.88%), Query Frame = 2
Query:   59 RWAVDFT-DNSTTPSTR-----DIADPPGFSRASQDQDDSTLSRQKKDAEANWKSQKAWEVAQAPFKNLXXXXXXXXXAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKDSKVDLLGPKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPALEVEYSGGGI 553
            +WAV+ +  NS + S R     D+  P G+S      D        ++A+ N   ++ W+VA  P K +         +G+T+ +F I +     W+PI AL  +   F+  + S    L   L+++  NL G AL ++K  ++GLLPTH+SDW++ + P   +E  GGG+
Sbjct:   24 KWAVELSLGNSRSRSDRQGKDGDVMYPVGYS------DKPVPDTSVQEADRNLVEKRCWDVALGPLKQIPMNLFIMYMSGNTISIFPIMMVCMMAWRPIQALMSMSATFKLLESSSQQWL-QGLVYLIGNLLGSALAIYKCQSMGLLPTHSSDWLAFIEPPQRLEIMGGGM 187          
BLAST of CK934069 vs. ExPASy Swiss-Prot
Match: TMM85_XENTR (Transmembrane protein 85 OS=Xenopus tropicalis GN=tmem85 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.070e-16
Identity = 55/180 (30.56%), Postives = 88/180 (48.89%), Query Frame = 2
Query:   41 VMGSGRR--WAVDFTDNSTTP-----STRDIADPPGFSRASQDQDDSTLSRQKKDAEANWKSQKAWEVAQAPFKNLXXXXXXXXXAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKDSKVDLLGPKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPALEVEYSGGGIPL 559
            V   GRR  WA++F    +         +D   P G+S      D        ++++     ++ W++A  P K +         AG+T+ +F I +     W+PI AL      F+  + S    L   L+++  NL GLAL V+K  ++GLLPTHASDW++ + P   +EY+GGG+ L
Sbjct:    8 VANRGRRFKWAIEFGSGGSRGRGERGGLQDSMYPVGYS------DKQVPDTSVQESDHILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPIMMVCMMAWRPIQALLATPATFKLLESSGQRFL-QGLVYLIGNLLGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEYTGGGLLL 180          
BLAST of CK934069 vs. ExPASy Swiss-Prot
Match: TMM85_SALSA (Transmembrane protein 85 OS=Salmo salar GN=tmem85 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.484e-14
Identity = 45/151 (29.80%), Postives = 76/151 (50.33%), Query Frame = 2
Query:  107 DIADPPGFSRASQDQDDSTLSRQKKDAEANWKSQKAWEVAQAPFKNLXXXXXXXXXAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKDSKVDLLGPKLLFIALNLGGLALGVWKLNTLGLLPTHASDWVSSLPPALEVEYSGGGIPL 559
            D+  P G+S      D        ++ + N   ++ W+VA  P K +         +G+T+ +F I +     W+PI AL  +   F+  ++S    L   L++   NL G AL ++K  ++GLLPTH+SDW++ + P   +E  GGG+ L
Sbjct:   45 DVMYPIGYS------DKPVPDTSIQETDKNLVEKRCWDVALGPLKQIPMNLFIMYMSGNTISIFPIMMVCMMAWRPIQALMSMSATFKLLENSNQQWL-QGLVYSVGNLLGSALAIYKCQSMGLLPTHSSDWLAFIEPPQRMEIMGGGMVL 188          
BLAST of CK934069 vs. ExPASy Swiss-Prot
Match: YQ13_SCHPO (Uncharacterized membrane protein C1281.03c OS=Schizosaccharomyces pombe GN=SPCC1281.03c PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.277e-12
Identity = 36/118 (30.51%), Postives = 65/118 (55.08%), Query Frame = 2
Query:  158 STLSRQKKDAEANWKSQKAWEVAQAPFKNLXXXXXXXXXAGSTVHLFSIGITFSALWQPISALQGVGKVFEPYKDSKVDLLGPKL-LFIALNLGGLALGVWKLNTLGLLPTHASDWVS 508
            S  ++++++ + +   +KAWE+A +P K +         +G+++ +FSI  T   L  P+ A+   G  F P+K +    L P +  +I   L  + +GV+KL  +GLLPT  SDW++
Sbjct:   57 SIFAKREEELQKDLLLKKAWELAYSPLKQIPMNAILAYMSGNSLQIFSIMTTLMLLVNPLKAITSTGSAFTPFKGTHPGTLWPAMGAYILFQLLLMGIGVYKLQRMGLLPTTTSDWLA 174          
The following BLAST results are available for this feature:
BLAST of CK934069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
TMM85_XENLA7.115e-1731.11Transmembrane protein 85 OS=Xenopus laevis GN=tmem... [more]
TMM85_BOVIN9.293e-1731.09Transmembrane protein 85 OS=Bos taurus GN=TMEM85 P... [more]
TMM85_PONAB1.585e-1631.09Transmembrane protein 85 OS=Pongo abelii GN=TMEM85... [more]
TMM85_MOUSE1.585e-1631.09Transmembrane protein 85 OS=Mus musculus GN=Tmem85... [more]
TMM85_HUMAN1.585e-1631.09Transmembrane protein 85 OS=Homo sapiens GN=TMEM85... [more]
TMM85_DANRE1.585e-1630.41Transmembrane protein 85 OS=Danio rerio GN=tmem85 ... [more]
TMM85_XENTR2.070e-1630.56Transmembrane protein 85 OS=Xenopus tropicalis GN=... [more]
TMM85_SALSA1.484e-1429.80Transmembrane protein 85 OS=Salmo salar GN=tmem85 ... [more]
YQ13_SCHPO5.277e-1230.51Uncharacterized membrane protein C1281.03c OS=Schi... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004541_G06 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IIIF_G06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934069 ID=CK934069|Name=CK934069|organism=Citrus sinensis|type=EST|length=910bp
GGGATCTTTGAATCCATCGAAAATGGAAAAAGGCAAAGGAGTGATGGGTT
CCGGGCGAAGATGGGCTGTTGATTTCACCGACAATTCAACGACTCCTTCC
ACTCGCGACATCGCTGACCCTCCGGGCTTCTCTCGGGCTTCTCAAGATCA
GGATGATTCAACGCTAAGTCGTCAAAAGAAAGATGCCGAAGCCAATTGGA
AATCTCAGAAAGCTTGGGAAGTGGCACAAGCCCCTTTCAAGAATCTGATG
ATGATGGGCTTTATGATGTGGATGGCGGGAAGTACTGTGCATCTGTTTAG
CATTGGTATTACTTTTTCAGCTCTCTGGCAGCCTATAAGTGCTCTACAAG
GGGTTGGAAAGGTTTTTGAGCCTTACAAGGACAGTAAAGTAGATCTTCTG
GGACCCAAGTTGCTGTTCATTGCCCTTAACTTGGGAGGCTTAGCACTGGG
TGTTTGGAAGCTTAACACATTGGGGCTTCTTCCGACACATGCATCGGATT
GGGTTTCATCCTTACCCCCCGCTCTGGAGGTCGAATATTCGGGTGGTGGC
ATTCCTCTGCAGTAAGGAAGTATCAGTGCTTGTTCACTTCAGTTTGTGAT
CATTTGCCAAGTATTGAAGTGAAAGGAAGTTGCAACTTGCAAGAGCTTGT
TTGTCTATCTGGGGAGCTGTTCTTGGTCGATGGCTTGTTATTGATCGGCA
TTGCTTGTTATTGATCGGCATTGCGGCCATTGACAATACACCACAAATGT
TATTTTTGAACATTGTTAACCGGATTGGTTGCCCTTGATATGACTCGGTA
GATCATTATTAAATATTATTGTTTATCATATAAAAATTATCCTTTCTGAA
CCAAGGATATTTATATGTTTGTAACTGTAGAGAGTTTTAACGGTGGTGGT
TTTTGTCCTG
back to top