CK934074

Overview
NameCK934074
Unique NameCK934074
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length789
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1654 contig Csv1_Contig1654:1..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934074 vs. ExPASy Swiss-Prot
Match: HSP81_ARATH (Heat shock protein 81-1 OS=Arabidopsis thaliana GN=HSP81-1 PE=1 SV=3)

HSP 1 Score: 417.927 bits (1073), Expect = 3.095e-116
Identity = 207/220 (94.09%), Postives = 218/220 (99.09%), Query Frame = 3
Query:  129 MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISD 788
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIR++PDK+NKTL+I+DSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAE+VVVTTKHNDDEQY+WESQAGGSFTVTRDV GEPLGRGTK+TL+LK+DQLEYLEERR+KDLVKKHSEFISYPIYLWTEKTTEKEISD
Sbjct:    1 MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKDDQLEYLEERRLKDLVKKHSEFISYPIYLWTEKTTEKEISD 220          
BLAST of CK934074 vs. ExPASy Swiss-Prot
Match: HSP83_IPONI (Heat shock protein 83 OS=Ipomoea nil GN=HSP83A PE=2 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 1.438e-113
Identity = 203/220 (92.27%), Postives = 214/220 (97.27%), Query Frame = 3
Query:  129 MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISD 788
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD QPELFIR++PDK NKTL+I+DSG+GM KADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAE+V+VTTKHNDDEQYIWESQAGGSFTVTRDV GE LGRGTK+TL+LKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISD
Sbjct:    6 MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQPELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGRGTKITLFLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISD 225          
BLAST of CK934074 vs. ExPASy Swiss-Prot
Match: HSP80_SOLLC (Heat shock cognate protein 80 OS=Solanum lycopersicum GN=HSC80 PE=2 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 2.076e-112
Identity = 204/220 (92.73%), Postives = 210/220 (95.45%), Query Frame = 3
Query:  129 MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISD 788
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFI IIPDKAN TLTI+DSGIGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQFGVGFYSAYLVAE+VVVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKM LYLKEDQLEYLEERR+KDL+KKHSEFISYPI LW EKT EKEISD
Sbjct:    1 MSDVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMVLYLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKTIEKEISD 220          
BLAST of CK934074 vs. ExPASy Swiss-Prot
Match: HSP82_ARATH (Heat shock protein 81-2 OS=Arabidopsis thaliana GN=HSP81-2 PE=1 SV=1)

HSP 1 Score: 404.06 bits (1037), Expect = 4.625e-112
Identity = 204/220 (92.73%), Postives = 209/220 (95.00%), Query Frame = 3
Query:  129 MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISD 788
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFI IIPDK N TLTI+DSGIGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQFGVGFYSAYLVA++VVVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKM LYLKEDQLEYLEERR+KDLVKKHSEFISYPI LW EKT EKEISD
Sbjct:    1 MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGETLGRGTKMVLYLKEDQLEYLEERRLKDLVKKHSEFISYPISLWIEKTIEKEISD 220          
BLAST of CK934074 vs. ExPASy Swiss-Prot
Match: HSP83_ARATH (Heat shock protein 81-3 OS=Arabidopsis thaliana GN=HSP81-3 PE=2 SV=2)

HSP 1 Score: 402.519 bits (1033), Expect = 1.346e-111
Identity = 202/220 (91.82%), Postives = 209/220 (95.00%), Query Frame = 3
Query:  129 MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISD 788
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFI IIPDK N TLTI+DSGIGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQFGVGFYSAYLVA++VVVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKM LYLKEDQ+EY+EERR+KDLVKKHSEFISYPI LW EKT EKEISD
Sbjct:    1 MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLKEDQMEYIEERRLKDLVKKHSEFISYPISLWIEKTIEKEISD 220          
BLAST of CK934074 vs. ExPASy Swiss-Prot
Match: HSP83_ORYSJ (Heat shock protein 81-3 OS=Oryza sativa subsp. japonica GN=HSP81-3 PE=2 SV=2)

HSP 1 Score: 401.364 bits (1030), Expect = 2.998e-111
Identity = 200/219 (91.32%), Postives = 212/219 (96.80%), Query Frame = 3
Query:  132 ADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISD 788
            ++TETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QPELFI I+PDKA+ TL+I+DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTK+TLYLK+DQLEYLEERR+KDLVKKHSEFISYPI LWTEKTTEKEISD
Sbjct:    3 SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTTEKEISD 221          
BLAST of CK934074 vs. ExPASy Swiss-Prot
Match: HSP82_ORYSJ (Heat shock protein 81-2 OS=Oryza sativa subsp. japonica GN=HSP81-2 PE=2 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 2.998e-111
Identity = 200/219 (91.32%), Postives = 212/219 (96.80%), Query Frame = 3
Query:  132 ADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISD 788
            ++TETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QPELFI I+PDKA+ TL+I+DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTK+TLYLK+DQLEYLEERR+KDLVKKHSEFISYPI LWTEKTTEKEISD
Sbjct:    3 SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTTEKEISD 221          
BLAST of CK934074 vs. ExPASy Swiss-Prot
Match: HSP81_ORYSJ (Heat shock protein 81-1 OS=Oryza sativa subsp. japonica GN=HSP81-1 PE=2 SV=2)

HSP 1 Score: 401.364 bits (1030), Expect = 2.998e-111
Identity = 200/219 (91.32%), Postives = 212/219 (96.80%), Query Frame = 3
Query:  132 ADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISD 788
            ++TETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QPELFI I+PDKA+ TL+I+DSGIGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTK+TLYLK+DQLEYLEERR+KDL+KKHSEFISYPI LWTEKTTEKEISD
Sbjct:    3 SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDDQLEYLEERRLKDLIKKHSEFISYPISLWTEKTTEKEISD 221          
BLAST of CK934074 vs. ExPASy Swiss-Prot
Match: HSP81_ORYSI (Heat shock protein 81-1 OS=Oryza sativa subsp. indica GN=HSP81-1 PE=2 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 2.998e-111
Identity = 200/219 (91.32%), Postives = 212/219 (96.80%), Query Frame = 3
Query:  132 ADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISD 788
            ++TETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QPELFI I+PDKA+ TL+I+DSGIGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTK+TLYLK+DQLEYLEERR+KDL+KKHSEFISYPI LWTEKTTEKEISD
Sbjct:    3 SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLKDDQLEYLEERRLKDLIKKHSEFISYPISLWTEKTTEKEISD 221          
BLAST of CK934074 vs. ExPASy Swiss-Prot
Match: HSP82_MAIZE (Heat shock protein 82 OS=Zea mays GN=HSP82 PE=3 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 3.102e-108
Identity = 194/220 (88.18%), Postives = 213/220 (96.82%), Query Frame = 3
Query:  132 ADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRIIPDKANKTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGA-DVSMIGQFGVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKMTLYLKEDQLEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEISD 788
            A+TETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKS ++ QPELFIR++PDKA+KTL+I+DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGA DVSMIGQFGVGFYSAYLVA+RV+VTTKHNDDEQY+WESQAGGSFTVT D +GE LGRGTK+TL+LK+DQLEYLEERR+KDLVKKHSEFISYPIYLWTEKTTEKEISD
Sbjct:   12 AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSNVNAQPELFIRLVPDKASKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGATDVSMIGQFGVGFYSAYLVADRVMVTTKHNDDEQYVWESQAGGSFTVTHDTTGEQLGRGTKITLFLKDDQLEYLEERRLKDLVKKHSEFISYPIYLWTEKTTEKEISD 231          
The following BLAST results are available for this feature:
BLAST of CK934074 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 380
Match NameE-valueIdentityDescription
HSP81_ARATH3.095e-11694.09Heat shock protein 81-1 OS=Arabidopsis thaliana GN... [more]
HSP83_IPONI1.438e-11392.27Heat shock protein 83 OS=Ipomoea nil GN=HSP83A PE=... [more]
HSP80_SOLLC2.076e-11292.73Heat shock cognate protein 80 OS=Solanum lycopersi... [more]
HSP82_ARATH4.625e-11292.73Heat shock protein 81-2 OS=Arabidopsis thaliana GN... [more]
HSP83_ARATH1.346e-11191.82Heat shock protein 81-3 OS=Arabidopsis thaliana GN... [more]
HSP83_ORYSJ2.998e-11191.32Heat shock protein 81-3 OS=Oryza sativa subsp. jap... [more]
HSP82_ORYSJ2.998e-11191.32Heat shock protein 81-2 OS=Oryza sativa subsp. jap... [more]
HSP81_ORYSJ2.998e-11191.32Heat shock protein 81-1 OS=Oryza sativa subsp. jap... [more]
HSP81_ORYSI2.998e-11191.32Heat shock protein 81-1 OS=Oryza sativa subsp. ind... [more]
HSP82_MAIZE3.102e-10888.18Heat shock protein 82 OS=Zea mays GN=HSP82 PE=3 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004541_F03 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IIIF_F03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934074 ID=CK934074|Name=CK934074|organism=Citrus sinensis|type=EST|length=789bp
GGGGGCCTTTCGCTTTATCAAAATCTCTCTGCGCAAGCCAAAGCAAAAGC
AAAAGCAATTCTCTTCAGTATTCTTGTTTCCAATTTTTTTCTTTTGTTTA
TTCTGTTTCTGTGTTGTGAGGAAGAGCAATGGCGGACACTGAGACATTCG
CATTCCAGGCAGAGATCAACCAGCTGTTGAGTTTGATCATCAATACTTTC
TACAGCAACAAGGAGATTTTCCTTCGTGAACTCATCAGCAACTCCTCTGA
TGCTTTGGACAAGATTCGATTCGAGAGCCTGACGGACAAGAGCAAGCTCG
ATGGACAACCAGAGCTTTTCATCAGAATCATCCCTGACAAGGCTAACAAG
ACGCTCACTATTGTTGATAGCGGTATCGGCATGACCAAAGCAGATTTGGT
AAATAATTTGGGTACAATTGCGAGATCCGGGACCAAGGAGTTTATGGAGG
CTTTGCAGGCCGGGGCTGATGTGTCAATGATTGGTCAATTTGGTGTTGGT
TTCTATTCGGCTTACCTTGTTGCTGAGAGGGTTGTTGTGACTACAAAGCA
CAATGACGATGAGCAATACATCTGGGAATCACAAGCTGGTGGTTCTTTCA
CTGTTACCAGGGATGTTAGTGGAGAGCCCCTTGGTAGAGGTACCAAGATG
ACTCTGTACCTCAAGGAGGATCAGCTTGAGTACTTGGAGGAGAGGAGAAT
TAAGGACCTTGTGAAGAAGCACTCTGAATTCATCAGCTACCCTATTTACC
TCTGGACTGAGAAGACAACTGAGAAGGAAATTAGCGATG
back to top