CK934078

Overview
NameCK934078
Unique NameCK934078
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length639
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8915 contig Csv1_Contig8915:21..659. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934078 vs. ExPASy Swiss-Prot
Match: SBP3_ARATH (Probable steroid-binding protein 3 OS=Arabidopsis thaliana GN=MP3 PE=1 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.011e-41
Identity = 82/99 (82.83%), Postives = 89/99 (89.90%), Query Frame = 2
Query:  119 MEFTPAQLIQYNGTDPSKPIYVAIKGRVFDVTTGKSFYGPGGAYAMFAGKDASRALAKMSKNDDDVTPSLDGLTEKEMGVLSDWEKKFEAKYPVVGRVV 415
            MEFT  QL QYNGTD SKPIYVAIKGRVFDVTTGKSFYG GG Y+MFAGKDASRAL KMSKN++DV+PSL+GLTEKE+  L+DWE KFEAKYPVVGRVV
Sbjct:    1 MEFTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSKNEEDVSPSLEGLTEKEINTLNDWETKFEAKYPVVGRVV 99          
BLAST of CK934078 vs. ExPASy Swiss-Prot
Match: MSBP1_ARATH (Membrane steroid-binding protein 1 OS=Arabidopsis thaliana GN=MSBP1 PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 1.916e-24
Identity = 54/97 (55.67%), Postives = 69/97 (71.13%), Query Frame = 2
Query:  122 EFTPAQLIQYNGTDPSKPIYVAIKGRVFDVTTGKSFYGPGGAYAMFAGKDASRALAKMSKNDDDVTPSLDGLTEKEMGVLSDWEKKFEAKYPVVGRV 412
            E T  +L QY+G+DP KP+ +AIK +++DVT  + FYGPGG YA+FAGKDASRALAKMS  + D+T  + GL   E+  L DWE KF +KY  VG V
Sbjct:   74 EITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEEKDLTWDVSGLGPFELDALQDWEYKFMSKYAKVGTV 170          
BLAST of CK934078 vs. ExPASy Swiss-Prot
Match: MSBP2_ARATH (Membrane steroid-binding protein 2 OS=Arabidopsis thaliana GN=MSBP2 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 9.509e-24
Identity = 52/97 (53.61%), Postives = 68/97 (70.10%), Query Frame = 2
Query:  122 EFTPAQLIQYNGTDPSKPIYVAIKGRVFDVTTGKSFYGPGGAYAMFAGKDASRALAKMSKNDDDVTPSLDGLTEKEMGVLSDWEKKFEAKYPVVGRV 412
            E T  +L  Y+G+D  KP+ +AIKG+++DV+  + FYGPGG YA+FAGKDASRALAKMS  D D+T  + GL   E+  L DWE KF +KY  VG +
Sbjct:   70 EITEEELKLYDGSDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEDQDLTGDISGLGAFELEALQDWEYKFMSKYVKVGTI 166          
BLAST of CK934078 vs. ExPASy Swiss-Prot
Match: NENF_RAT (Neudesin OS=Rattus norvegicus GN=Nenf PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 4.417e-21
Identity = 49/95 (51.58%), Postives = 67/95 (70.53%), Query Frame = 2
Query:  125 FTPAQLIQYNGTDPSKPIYVAIKGRVFDVTTGKSFYGPGGAYAMFAGKDASRALAKMSKNDDDVTPSLDGLTEKEMGVLSD-WEKKFEAKYPVVG 406
            FT  +L +Y+G +  +PIY+A+KG VFDVT+GK FYG G  Y   AGKD+SR +AKMS +  D+T  + GLT KE+  L D + K ++AKYP+VG
Sbjct:   46 FTEEELARYSGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALAGKDSSRGVAKMSLDPADLTHDISGLTAKELEALDDIFSKVYKAKYPIVG 140          
BLAST of CK934078 vs. ExPASy Swiss-Prot
Match: NENF_MOUSE (Neudesin OS=Mus musculus GN=Nenf PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.678e-20
Identity = 49/95 (51.58%), Postives = 65/95 (68.42%), Query Frame = 2
Query:  125 FTPAQLIQYNGTDPSKPIYVAIKGRVFDVTTGKSFYGPGGAYAMFAGKDASRALAKMSKNDDDVTPSLDGLTEKEMGVLSD-WEKKFEAKYPVVG 406
            FT  +L +Y G +  +PIY+A+KG VFDVT+GK FYG G  Y   AGKD+SR +AKMS +  D+T    GLT KE+  L D + K ++AKYP+VG
Sbjct:   46 FTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALAGKDSSRGVAKMSLDPADLTHDTTGLTAKELEALDDVFSKVYKAKYPIVG 140          
BLAST of CK934078 vs. ExPASy Swiss-Prot
Match: NENF_HUMAN (Neudesin OS=Homo sapiens GN=NENF PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.134e-19
Identity = 46/95 (48.42%), Postives = 64/95 (67.37%), Query Frame = 2
Query:  125 FTPAQLIQYNGTDPSKPIYVAIKGRVFDVTTGKSFYGPGGAYAMFAGKDASRALAKMSKNDDDVTPSLDGLTEKEMGVLSD-WEKKFEAKYPVVG 406
            FT  +L +Y G +  +PIY+A+KG VFDVT+GK FYG G  Y    GKD++R +AKMS +  D+T    GLT KE+  L + + K ++AKYP+VG
Sbjct:   47 FTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVG 141          
BLAST of CK934078 vs. ExPASy Swiss-Prot
Match: DAP1_SCHPO (Cytochrome P450 regulator dap1 OS=Schizosaccharomyces pombe GN=dap1 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 7.052e-19
Identity = 56/145 (38.62%), Postives = 82/145 (56.55%), Query Frame = 2
Query:   26 SINLIFLTSLPLLSVRTATNQTRRSSFVHSS-------MEFTPAQLIQYNGTDPSKPIYVAIKGRVFDVTTGKSFYGPGGAYAMFAGKDASRALAKMSKNDDDVTPSLDG--------LTEKEMGVLSDWEKKFEAKYPVVGRVV 415
            S  ++F+ +L L  + T   +    SF+ S         ++TPA+L +YNG+  S  +++AIKG V++VT G  FYGP G Y+ FAG DASR LAK S  DD+  P  D         L ++E   L+DW+  F+ KY  VGR++
Sbjct:    3 STQVVFIVTLFLYLLITRWRRKNEKSFIASEEPKQPEWRDYTPAELKEYNGSKNSL-VFLAIKGTVYNVTMGSKFYGPQGPYSAFAGHDASRGLAKNS-FDDEFIPDSDAEELDDCSDLNDEERQALNDWKAFFDQKYQAVGRLI 145          
BLAST of CK934078 vs. ExPASy Swiss-Prot
Match: NENF_BOVIN (Neudesin OS=Bos taurus GN=NENF PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.571e-18
Identity = 45/95 (47.37%), Postives = 64/95 (67.37%), Query Frame = 2
Query:  125 FTPAQLIQYNGTDPSKPIYVAIKGRVFDVTTGKSFYGPGGAYAMFAGKDASRALAKMSKNDDDVTPSLDGLTEKEMGVLSD-WEKKFEAKYPVVG 406
            FT  +L +Y G +  +PIY+A+KG VFDVT+GK FYG G  Y    GKD++R +AKMS +  D+T    GLT +E+  L D + + ++AKYP+VG
Sbjct:   44 FTEEELARYGGEEEDQPIYMAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAEELESLDDVFTRVYKAKYPIVG 138          
BLAST of CK934078 vs. ExPASy Swiss-Prot
Match: DAP1_YEAST (Damage response protein 1 OS=Saccharomyces cerevisiae GN=DAP1 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.571e-18
Identity = 48/118 (40.68%), Postives = 70/118 (59.32%), Query Frame = 2
Query:   80 TNQTRRSSFVHSSMEFTPAQLIQYNGTDPSKPIYVAIKGRVFDVTTGKSFYGPGGAYAMFAGKDASRALAKMS------KNDDDVTPSLDGLTEKEMGVLSDWEKKFEAKYPVVGRVV 415
            TN + + S    +  F P  L ++NG D  K I++AI+G+V+D T G+ FYGP G Y  FAG DASR LA  S      K+ D     LD LT++++  L +W++ FE KYP +G ++
Sbjct:   29 TNDSNKGSEPVVAGNFFPRTLSKFNGHDDEK-IFIAIRGKVYDCTRGRQFYGPSGPYTNFAGHDASRGLALNSFDLDVIKDWDQPIDPLDDLTKEQIDALDEWQEHFENKYPCIGTLI 145          
BLAST of CK934078 vs. ExPASy Swiss-Prot
Match: PGRC1_PONAB (Membrane-associated progesterone receptor component 1 OS=Pongo abelii GN=PGRMC1 PE=2 SV=3)

HSP 1 Score: 85.5001 bits (210), Expect = 2.508e-16
Identity = 45/101 (44.55%), Postives = 63/101 (62.38%), Query Frame = 2
Query:  122 EFTPAQLIQYNGTDPSKPIYVAIKGRVFDVTTGKSFYGPGGAYAMFAGKDASRALAKMSKNDD---DVTPSLDGLTEKEMGVLSDWEKKFEAKYPVVGRVV 415
            +FTPA+L +++G    + I +AI G+VFDVT G+ FYGP G Y +FAG+DASR LA    + +   D    L  LT  +   LSDWE +F  KY  VG+++
Sbjct:   72 DFTPAELRRFDGVQDPR-ILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLL 171          
The following BLAST results are available for this feature:
BLAST of CK934078 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
SBP3_ARATH1.011e-4182.83Probable steroid-binding protein 3 OS=Arabidopsis ... [more]
MSBP1_ARATH1.916e-2455.67Membrane steroid-binding protein 1 OS=Arabidopsis ... [more]
MSBP2_ARATH9.509e-2453.61Membrane steroid-binding protein 2 OS=Arabidopsis ... [more]
NENF_RAT4.417e-2151.58Neudesin OS=Rattus norvegicus GN=Nenf PE=2 SV=1[more]
NENF_MOUSE1.678e-2051.58Neudesin OS=Mus musculus GN=Nenf PE=1 SV=1[more]
NENF_HUMAN4.134e-1948.42Neudesin OS=Homo sapiens GN=NENF PE=1 SV=1[more]
DAP1_SCHPO7.052e-1938.62Cytochrome P450 regulator dap1 OS=Schizosaccharomy... [more]
NENF_BOVIN1.571e-1847.37Neudesin OS=Bos taurus GN=NENF PE=2 SV=1[more]
DAP1_YEAST4.571e-1840.68Damage response protein 1 OS=Saccharomyces cerevis... [more]
PGRC1_PONAB2.508e-1644.55Membrane-associated progesterone receptor componen... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004541_F07 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IIIF_F07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934078 ID=CK934078|Name=CK934078|organism=Citrus sinensis|type=EST|length=639bp
GGGGGAAGTCTAAACCAACAACAAAAGCATTAACCTTATCTTTCTCACAT
CTCTTCCACTACTCTCAGTACGCACCGCTACCAACCAAACCAGACGATCA
TCGTTCGTTCATTCGTCAATGGAATTCACACCGGCTCAGCTGATCCAATA
CAACGGAACAGACCCATCAAAACCAATATACGTGGCAATCAAAGGCCGCG
TGTTCGACGTGACAACAGGCAAGTCCTTTTACGGCCCAGGTGGCGCGTAC
GCGATGTTCGCAGGCAAAGATGCCAGCAGAGCTTTGGCTAAGATGAGCAA
GAATGATGACGATGTCACTCCCTCCCTCGATGGCCTCACAGAGAAAGAGA
TGGGCGTTCTTAGTGACTGGGAGAAGAAATTCGAAGCTAAGTACCCAGTT
GTGGGTCGTGTTGTTTAATAAATTTTTTATCTTTTTATGAATTTACTTGT
TATGATTATGCATTTTACGTTTATATGTCTATTTTTTTGTGTTTATTTGT
AAGGTGATCTACTGAAAGCTCTTATCTTTATGTGGGTATTGAGTGAGGAG
TGTGTATGATTAAAAGTTTGTAAGGGAATGAATGGTTAATAAATGAATGC
GAGTTGTGTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top