CK934079

Overview
NameCK934079
Unique NameCK934079
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length745
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2951 contig Csv1_Contig2951:60..804. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934079 vs. ExPASy Swiss-Prot
Match: AVT4_YEAST (Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae GN=AVT4 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.785e-12
Identity = 55/221 (24.89%), Postives = 103/221 (46.61%), Query Frame = 3
Query:    6 FEGFGMTFALESSMRERGRFSKLLAQAFTGITLVYVTFGFFGFMAYGDDTKDIVTLNLPKDWSSI-AVQMGLCVALIFTFPIMVHPVHEIIEGSL--KKSSFFQTHPCISYDNNSTTRLGK--FMIYISRXXXXXXXXXXXSFIPGFGT-----FTSLVGSTLCALISFVLPALYHLILLGSSL-----NFW--QRSLDVCILLCGLLFAVNGTYNSIVGV 617
            FEG G+   ++ SMR   +F  +LA      T+++++    G++AYG + + ++ LNLP+    +  +Q+   +A++ + P+ + P  +IIE     K +  +  H  ++         GK  + I   +             I  FG+     F S++GS  C  + ++ P++ H  L G+SL      FW  +  LD  ++  G+   +  +Y SI GV
Sbjct:  495 FEGIGLIIPVQDSMRNPEKFPLVLALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQLFYSIAIMLSTPLQLFPAIKIIENKFFPKFTKIYVKHDDLTTRVELRPNSGKLNWKIKWLKNFIRSIIVIIVVSIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLH--LRGNSLPETKGEFWRFKPMLDTILIFFGIASMLYTSYQSIFGV 713          
BLAST of CK934079 vs. ExPASy Swiss-Prot
Match: S36A4_XENLA (Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 4.185e-11
Identity = 54/203 (26.60%), Postives = 87/203 (42.86%), Query Frame = 3
Query:    6 FEGFGMTFALESSMRERGRFSKLLAQAFTGITLVYVTFGFFGFMAYGDDTKDIVTLNLPKD-WSSIAVQMGLCVALIFTFPIMVHPVHEIIEGSLKKSSFFQTHPCISYDNNSTTRLGKFMIYISRXXXXXXXXXXXSFIPGFGTFTSLVGSTLCALISFVLPALYHLILL-GSSLNFWQRSLDVCILLCGLLFAVNGTYNSI 608
            FEG G+   LE+ MR++  FSK L      +T +Y++    G+  +GD  K  +TLNLP+D W    V++     +  T+ I  +   EII             P ++     T +L     +  R             IP      S VG+   + ++ +LP L  +I     +L+ W    DV I + G +  + GTY +I
Sbjct:  304 FEGIGVVLPLENRMRDKKDFSKALNIGMAIVTTLYISLATLGYFCFGDQIKGSITLNLPQDSWLYQLVKILYSFGIYVTYAIQYYVPAEII------------LPAVTSRVQKTRKL--LCEFTMRFFLVCLTCAVAVLIPRLDLVISFVGAVSSSTLALILPPLVEIITYHKENLSPWVIMKDVGIAVIGFVGFIAGTYVTI 492          
BLAST of CK934079 vs. ExPASy Swiss-Prot
Match: S36A4_HUMAN (Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 9.322e-11
Identity = 52/203 (25.62%), Postives = 90/203 (44.33%), Query Frame = 3
Query:    6 FEGFGMTFALESSMRERGRFSKLLAQAFTGITLVYVTFGFFGFMAYGDDTKDIVTLNLPKD-WSSIAVQMGLCVALIFTFPIMVHPVHEIIEGSLKKSSFFQTHPCISYDNNSTTRLGKFMIYISRXXXXXXXXXXXSFIPGFGTFTSLVGSTLCALISFVLPALYHLILLGSS-LNFWQRSLDVCILLCGLLFAVNGTYNSI 608
            FEG G+   LE+ M+E  RF + L      +T +YVT    G+M + D+ K  +TLNLP+D W   +V++     +  T+ I  +   EII   +  +S F T     +       +  F++ I+              IP      S VG+   + ++ +LP L  ++       N W    ++ I   G++  + GTY ++
Sbjct:  284 FEGIGVVLPLENQMKESKRFPQALNIGMGIVTTLYVTLATLGYMCFHDEIKGSITLNLPQDVWLYQSVKILYSFGIFVTYSIQFYVPAEIIIPGI--TSKFHT----KWKQICEFGIRSFLVSIT--------CAGAILIPRLDIVISFVGAVSSSTLALILPPLVEILTFSKEHYNIWMVLKNISIAFTGVVGFLLGTYITV 472          
The following BLAST results are available for this feature:
BLAST of CK934079 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
AVT4_YEAST3.785e-1224.89Vacuolar amino acid transporter 4 OS=Saccharomyces... [more]
S36A4_XENLA4.185e-1126.60Proton-coupled amino acid transporter 4 OS=Xenopus... [more]
S36A4_HUMAN9.322e-1125.62Proton-coupled amino acid transporter 4 OS=Homo sa... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004541_F08 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IIIF_F08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934079 ID=CK934079|Name=CK934079|organism=Citrus sinensis|type=EST|length=745bp
GGGGTTTTGAAGGATTTGGTATGACTTTTGCATTAGAGTCATCAATGAGA
GAAAGAGGAAGGTTTTCCAAGTTGCTTGCTCAGGCTTTTACTGGGATAAC
TCTTGTGTATGTTACGTTTGGTTTTTTCGGTTTCATGGCGTATGGTGATG
ACACTAAGGATATTGTTACTCTGAATCTGCCTAAAGATTGGTCTTCCATT
GCAGTTCAGATGGGGTTGTGTGTGGCACTCATATTTACATTTCCGATCAT
GGTACACCCGGTTCACGAGATTATAGAGGGGAGTTTGAAGAAGAGCTCGT
TCTTTCAAACGCACCCGTGCATTTCTTATGACAACAATTCGACCACTAGA
TTAGGAAAGTTCATGATATACATAAGTCGAGCAATTTTGGTGGTTGCACT
AGCAGCAATAGCATCGTTCATACCAGGATTTGGTACATTCACATCGCTTG
TGGGCAGCACCTTATGTGCTCTAATCTCTTTTGTTTTGCCAGCTTTATAC
CACTTAATATTGCTAGGCTCATCTTTGAATTTCTGGCAAAGATCTCTTGA
TGTTTGCATATTGCTGTGTGGATTGCTTTTCGCCGTGAATGGTACTTATA
ACTCCATAGTAGGAGTTTGAACAAATCTGGTATGTTCACAACGGACGAAA
CGTACCGGCAAATTTGTTTTCTTAGAATTGTGTATTCTGATTTTGTAATA
GATGCAAGGGCTTCAAACAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top