CK934085

Overview
NameCK934085
Unique NameCK934085
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length526
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK934085_ssr363 microsatellite CK934085_ssr363:363..374. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig5337 contig Csv1_Contig5337:79..604. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934085 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSJ (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica GN=LTI6B PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.914e-13
Identity = 35/53 (66.04%), Postives = 36/53 (67.92%), Query Frame = 3
Query:   48 GTATCXXXXXXXXXXXXGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 206
            GTA C            GVFLKFGC  EFWICLLLT  GYIPGIIYA+YAITK
Sbjct:    3 GTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55          
BLAST of CK934085 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSI (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica GN=LTI6B PE=3 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 2.914e-13
Identity = 35/53 (66.04%), Postives = 36/53 (67.92%), Query Frame = 3
Query:   48 GTATCXXXXXXXXXXXXGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 206
            GTA C            GVFLKFGC  EFWICLLLT  GYIPGIIYA+YAITK
Sbjct:    3 GTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55          
BLAST of CK934085 vs. ExPASy Swiss-Prot
Match: LTI6A_ORYSJ (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica GN=LTI6A PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.914e-13
Identity = 36/57 (63.16%), Postives = 39/57 (68.42%), Query Frame = 3
Query:   36 MADEGTATCXXXXXXXXXXXXGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 206
            MAD  TATC            GVF KFGC +EFWICLLLT FGY+PGIIYAV+ ITK
Sbjct:    1 MADS-TATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 56          
BLAST of CK934085 vs. ExPASy Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 6.491e-13
Identity = 30/36 (83.33%), Postives = 35/36 (97.22%), Query Frame = 3
Query:   99 GVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 206
            GVFLKFGCKVEFWICL+LT+FGY+PGI+YA+Y ITK
Sbjct:   19 GVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54          
BLAST of CK934085 vs. ExPASy Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.599e-11
Identity = 28/36 (77.78%), Postives = 33/36 (91.67%), Query Frame = 3
Query:   99 GVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 206
            GVFL+FGC VEFWICL+LT+ GYIPGIIYA+Y +TK
Sbjct:   19 GVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54          
The following BLAST results are available for this feature:
BLAST of CK934085 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
LTI6B_ORYSJ2.914e-1366.04Hydrophobic protein LTI6B OS=Oryza sativa subsp. j... [more]
LTI6B_ORYSI2.914e-1366.04Hydrophobic protein LTI6B OS=Oryza sativa subsp. i... [more]
LTI6A_ORYSJ2.914e-1363.16Hydrophobic protein LTI6A OS=Oryza sativa subsp. j... [more]
RCI2B_ARATH6.491e-1383.33Hydrophobic protein RCI2B OS=Arabidopsis thaliana ... [more]
RCI2A_ARATH1.599e-1177.78Hydrophobic protein RCI2A OS=Arabidopsis thaliana ... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004541_E06 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IIIF_E06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934085 ID=CK934085|Name=CK934085|organism=Citrus sinensis|type=EST|length=526bp
TTTTTTTTTTTTTTTTTTGTAAGAATCAATCAAAGATGGCAGATGAAGGC
ACAGCAACATGCATTGATATTATCTTGGCTATCATTTTGCCTCCTCTCGG
TGTCTTTCTCAAATTTGGCTGCAAGGTTGAGTTTTGGATCTGTTTGCTGT
TGACAATTTTCGGGTATATCCCTGGAATTATTTATGCTGTTTATGCCATC
ACCAAGAATTGATCTCTCTCTTCTTATTCTATGGAGAGATCTGAGGGGCA
GTATGTGTTTATGAGATTTTTATTTACAACCATTTGATGGACAGTTCTGA
TTTGATGTAGCCAGATGGATTATGATTCTTCTTTTAAGTGTTGTGTGTGC
GCGTGTGTGAGAGAGTGAGTGAGTGAAGTGTTCCTTTGTTGATCTTTAAT
TTTTTCCGCCCTTTTTGTATGATTTGTCCCTTTTATGAACTTTAGTTCAT
TATTTTAATGTAAATTCCGCGACAGAAAATTTTTCTTGGGCCAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAACATG
back to top