CK934225

Overview
NameCK934225
Unique NameCK934225
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length609
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK934225 vs. ExPASy Swiss-Prot
Match: GAST1_SOLLC (Protein GAST1 OS=Solanum lycopersicum GN=GAST1 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.948e-39
Identity = 72/118 (61.02%), Postives = 85/118 (72.03%), Query Frame = 1
Query:   79 MASKLSVVAFSLVLIFLFLVENHATSIVEAPTPQPAESSGRNGNHSTYGTTQGSLQPQECGPRCTTRCSKTQYRKPCLFFCQKCCAKCLCVPAGFYGNKQSCPCYNNWKTKRGGPKCP 432
            MA K+S+V F  VL+ +FL +N     V        E   +  N+  YG ++G L PQ+C P+CT RCSKT Y+KPC+FFCQKCCAKCLCVPAG YGNKQSCPCYNNWKTKRGGPKCP
Sbjct:    1 MAGKMSIVLF--VLLVVFLTQNQ----VSRANIMRDEQQQQQRNNQLYGVSEGRLHPQDCQPKCTYRCSKTSYKKPCMFFCQKCCAKCLCVPAGTYGNKQSCPCYNNWKTKRGGPKCP 112          
BLAST of CK934225 vs. ExPASy Swiss-Prot
Match: RSI1_SOLLC (Protein RSI-1 OS=Solanum lycopersicum GN=RSI-1 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.639e-28
Identity = 48/64 (75.00%), Postives = 54/64 (84.38%), Query Frame = 1
Query:  241 LQPQECGPRCTTRCSKTQYRKPCLFFCQKCCAKCLCVPAGFYGNKQSCPCYNNWKTKRGGPKCP 432
            L+P +C PRCT RCS T ++KPC+FFCQKCCA CLCVP G YGNKQSCPCYNNWKT+ G PKCP
Sbjct:   33 LRPTDCKPRCTYRCSATSHKKPCMFFCQKCCATCLCVPKGVYGNKQSCPCYNNWKTQEGKPKCP 96          
BLAST of CK934225 vs. ExPASy Swiss-Prot
Match: GASA4_ARATH (Gibberellin-regulated protein 4 OS=Arabidopsis thaliana GN=GASA4 PE=1 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 1.448e-26
Identity = 55/109 (50.46%), Postives = 64/109 (58.72%), Query Frame = 1
Query:  106 FSLVLIFLFLVENHATSIVEAPTPQPAESSGRNGNHSTYGTTQGSLQPQECGPRCTTRCSKTQYRKPCLFFCQKCCAKCLCVPAGFYGNKQSCPCYNNWKTKRGGPKCP 432
            F L LI LF+++    +           SSG N   S      GSL+  +C   C  RC KTQY K C+ FC KCC KCLCVP G+YGNKQ C CYNNWKT+ GGPKCP
Sbjct:    9 FLLTLIVLFMLQTMVMA-----------SSGSNVKWSQKRYGPGSLKRTQCPSECDRRCKKTQYHKACITFCNKCCRKCLCVPPGYYGNKQVCSCYNNWKTQEGGPKCP 106          
BLAST of CK934225 vs. ExPASy Swiss-Prot
Match: SNAK1_SOLTU (Snakin-1 OS=Solanum tuberosum GN=SN1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.398e-13
Identity = 29/59 (49.15%), Postives = 35/59 (59.32%), Query Frame = 1
Query:  256 CGPRCTTRCSKTQYRKPCLFFCQKCCAKCLCVPAGFYGNKQSCPCYNNWKTKRGGPKCP 432
            C  +C  RCSK      CL +C  CC +C CVP+G YGNK  CPCY + K  +G  KCP
Sbjct:   30 CDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP 88          
BLAST of CK934225 vs. ExPASy Swiss-Prot
Match: GASA2_ARATH (Gibberellin-regulated protein 2 OS=Arabidopsis thaliana GN=GASA2 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.651e-12
Identity = 30/60 (50.00%), Postives = 35/60 (58.33%), Query Frame = 1
Query:  253 ECGPRCTTRCSKTQYRKPCLFFCQKCCAKCLCVPAGFYGNKQSCPCYNNWKTKRGGPKCP 432
            +CG RC  RCSK+   K CL  C  CC++C CVP G  GN   CPCY +  T  G  KCP
Sbjct:   40 DCGGRCKDRCSKSSRTKLCLRACNSCCSRCNCVPPGTSGNTHLCPCYASITTHGGRLKCP 99          
BLAST of CK934225 vs. ExPASy Swiss-Prot
Match: GASA3_ARATH (Gibberellin-regulated protein 3 OS=Arabidopsis thaliana GN=GASA3 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.718e-11
Identity = 29/60 (48.33%), Postives = 34/60 (56.67%), Query Frame = 1
Query:  253 ECGPRCTTRCSKTQYRKPCLFFCQKCCAKCLCVPAGFYGNKQSCPCYNNWKTKRGGPKCP 432
            +CG RC  RCSK+     CL  C  CC +C CVP G  GN   CPCY +  T+ G  KCP
Sbjct:   40 DCGGRCKGRCSKSSRPNLCLRACNSCCYRCNCVPPGTAGNHHLCPCYASITTRGGRLKCP 99          
The following BLAST results are available for this feature:
BLAST of CK934225 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
GAST1_SOLLC1.948e-3961.02Protein GAST1 OS=Solanum lycopersicum GN=GAST1 PE=... [more]
RSI1_SOLLC2.639e-2875.00Protein RSI-1 OS=Solanum lycopersicum GN=RSI-1 PE=... [more]
GASA4_ARATH1.448e-2650.46Gibberellin-regulated protein 4 OS=Arabidopsis tha... [more]
SNAK1_SOLTU2.398e-1349.15Snakin-1 OS=Solanum tuberosum GN=SN1 PE=1 SV=1[more]
GASA2_ARATH2.651e-1250.00Gibberellin-regulated protein 2 OS=Arabidopsis tha... [more]
GASA3_ARATH1.718e-1148.33Gibberellin-regulated protein 3 OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004261_H01 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IVF_H01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934225 ID=CK934225|Name=CK934225|organism=Citrus sinensis|type=EST|length=609bp
GGGGATTCTCACTTCCTCTNNNNNNCTTCCTCTATATCTCTTTATCCCTT
CTCTGTCCTTGCTGCACACTTACTGAAAATGGCAAGCAAGCTTAGTGTTG
TAGCATTCTCTCTTGTTTTGATTTTTCTTTTTCTTGTGGAGAATCATGCT
ACCAGCATTGTTGAGGCTCCAACTCCGCAGCCTGCAGAGTCAAGTGGTAG
AAACGGCAACCATTCCACGTACGGTACCACCCAAGGAAGTCTTCAACCTC
AAGAGTGCGGACCACGATGCACGACAAGATGCTCAAAGACACAATACAGG
AAGCCATGCTTGTTCTTCTGTCAAAAGTGCTGTGCCAAGTGCTTGTGTGT
GCCTGCTGGATTTTATGGAAACAAGCAATCCTGCCCTTGCTACAATAACT
GGAAAACTAAGAGAGGAGGACCGAAATGCCCTTGAACTGCTCATTATTAA
TTAACTTTTATTCCATAAACGTACCTTTTGATTACTTGATTTCACCTCAA
TTTAACTTTTAGTATGTTTATATCTGATATTAATTTTGTTTGTTCATTTG
TTTACTACTTATATATGTTACATAGTTCGATACAAAAAAAAAAAAAAAAA
AAAAAAAAA
back to top