CK934227

Overview
NameCK934227
Unique NameCK934227
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length761
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:21..781. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934227 vs. ExPASy Swiss-Prot
Match: CB2G_SOLLC (Chlorophyll a-b binding protein 3C, chloroplastic OS=Solanum lycopersicum GN=CAB3C PE=3 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 5.921e-117
Identity = 204/230 (88.70%), Postives = 215/230 (93.48%), Query Frame = 3
Query:   78 MATSTMGLSSS-FVGKAVNLAPSGNDLSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEDGLDYLGNPSLIHAQSILAIWACLVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 758
            MATSTM LSSS F GKAV L+PS ++++  GR++MRKT +K+   SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSE GLDYLGNPSL+HAQSILAIWAC VVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF
Sbjct:    1 MATSTMALSSSTFAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 230          
BLAST of CK934227 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 2.939e-116
Identity = 202/230 (87.83%), Postives = 215/230 (93.48%), Query Frame = 3
Query:   78 MATSTMGLSS-SFVGKAVNLAPSGNDLSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEDGLDYLGNPSLIHAQSILAIWACLVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 758
            MA STM LSS SF GKAV L+PS ++++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSE GLDYLGNPSL+HAQSILAIWAC VVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFF
Sbjct:    1 MAASTMALSSPSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF 230          
BLAST of CK934227 vs. ExPASy Swiss-Prot
Match: CB21_TOBAC (Chlorophyll a-b binding protein 16, chloroplastic OS=Nicotiana tabacum GN=CAB16 PE=2 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 2.939e-116
Identity = 200/229 (87.34%), Postives = 213/229 (93.01%), Query Frame = 3
Query:   78 MATSTMGLSSSFVGKAVNLAPSGNDLSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEDGLDYLGNPSLIHAQSILAIWACLVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 758
            MA ST  LSS F GKAV L+PS ++++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSE GLDYLGNPSL+HAQSILAIWAC VVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFF
Sbjct:    1 MAASTTALSSPFAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF 229          
BLAST of CK934227 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 3.249e-115
Identity = 200/228 (87.72%), Postives = 211/228 (92.54%), Query Frame = 3
Query:   78 MATSTMGLSS-SFVGKAVNLAPSGNDLSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEDGLDYLGNPSLIHAQSILAIWACLVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 758
            MA +TM LSS SF G+AV L+PS +++S  GRI+MRK  +KS  S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSE GLDYLGNPSL+HAQSILAIWAC VVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFF
Sbjct:    1 MAAATMALSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF 228          
BLAST of CK934227 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 3.249e-115
Identity = 198/228 (86.84%), Postives = 212/228 (92.98%), Query Frame = 3
Query:   78 MATSTMGLSS-SFVGKAVNLAPSGNDLSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEDGLDYLGNPSLIHAQSILAIWACLVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 758
            MA +TM LSS SF G+AV L+PS  +++  GR+SMRKT +K V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSE GLDYLGNPSL+HAQSILAIWAC V+LMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFF
Sbjct:    1 MAAATMALSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF 228          
BLAST of CK934227 vs. ExPASy Swiss-Prot
Match: CB25_NICPL (Chlorophyll a-b binding protein E, chloroplastic OS=Nicotiana plumbaginifolia GN=CABE PE=3 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 5.542e-115
Identity = 198/229 (86.46%), Postives = 212/229 (92.58%), Query Frame = 3
Query:   78 MATSTMGLSSSFVGKAVNLAPSGNDLSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEDGLDYLGNPSLIHAQSILAIWACLVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 758
            MA ST  LSS F GKAV L+PS ++++  G+++MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSE GLDYLGNPSL+HAQSILAIWAC VVLMGAVEGYR+AG PLGEV DPLYPGGSFDPLGLA+DPEAFAELKVKEIKNGRLAMFSMFGFF
Sbjct:    1 MAASTTALSSPFAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF 229          
BLAST of CK934227 vs. ExPASy Swiss-Prot
Match: CB27_TOBAC (Chlorophyll a-b binding protein 7, chloroplastic OS=Nicotiana tabacum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 1.235e-114
Identity = 200/230 (86.96%), Postives = 212/230 (92.17%), Query Frame = 3
Query:   78 MATSTMGLSS-SFVGKAVNLAPSGNDLSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEDGLDYLGNPSLIHAQSILAIWACLVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 758
            M  STM LSS SF G AV L+PS ++++  G+  MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSE GLDYLGNPSL+HAQSILAIWAC VVLMGA+EGYR+AGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF
Sbjct:    1 MTASTMALSSPSFAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 230          
BLAST of CK934227 vs. ExPASy Swiss-Prot
Match: CB25_TOBAC (Chlorophyll a-b binding protein 50, chloroplastic OS=Nicotiana tabacum GN=CAB50 PE=2 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 2.751e-114
Identity = 198/230 (86.09%), Postives = 214/230 (93.04%), Query Frame = 3
Query:   78 MATSTMGLSSS-FVGKAVNLAPSGNDLSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEDGLDYLGNPSLIHAQSILAIWACLVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 758
            MA +TM LSSS F GKAV L+PS ++++  G+++MRKT +K+  +SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSE GLDYLGNPSL+HAQSILAIWAC VVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELKVK IKNGRLAMFSMFGFF
Sbjct:    1 MAAATMALSSSSFAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKHIKNGRLAMFSMFGFF 230          
BLAST of CK934227 vs. ExPASy Swiss-Prot
Match: CB2A_SPIOL (Chlorophyll a-b binding protein, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 6.128e-114
Identity = 200/230 (86.96%), Postives = 210/230 (91.30%), Query Frame = 3
Query:   78 MATSTMGLSS-SFVGKAVNLAPSGNDLSNGGRISMRKTGSK--SVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEDGLDYLGNPSLIHAQSILAIWACLVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 758
            MA+STM LSS S  GKAV L P+ +++   GRI+MRKT  K  +V S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSE GLDYLGNPSL+HAQSILAIWAC V+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF
Sbjct:    1 MASSTMALSSPSLAGKAVKLGPTASEIIGEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 230          
BLAST of CK934227 vs. ExPASy Swiss-Prot
Match: CB25_PETSP (Chlorophyll a-b binding protein 91R, chloroplastic OS=Petunia sp. GN=CAB91R PE=3 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 8.003e-114
Identity = 199/230 (86.52%), Postives = 212/230 (92.17%), Query Frame = 3
Query:   78 MATSTMGLSS-SFVGKAVNLAPSGNDLSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEDGLDYLGNPSLIHAQSILAIWACLVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 758
            MA +TM LSS SF GKAV  +PS ++++  G+ +MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTA LSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSE GLDYLGNPSL+HAQSILAIWAC VVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF
Sbjct:    1 MAAATMALSSPSFAGKAVKFSPSSSEITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAELSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF 230          
The following BLAST results are available for this feature:
BLAST of CK934227 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
CB2G_SOLLC5.921e-11788.70Chlorophyll a-b binding protein 3C, chloroplastic ... [more]
CB24_TOBAC2.939e-11687.83Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB21_TOBAC2.939e-11687.34Chlorophyll a-b binding protein 16, chloroplastic ... [more]
CB2B_SOLLC3.249e-11587.72Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB22_TOBAC3.249e-11586.84Chlorophyll a-b binding protein 21, chloroplastic ... [more]
CB25_NICPL5.542e-11586.46Chlorophyll a-b binding protein E, chloroplastic O... [more]
CB27_TOBAC1.235e-11486.96Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB25_TOBAC2.751e-11486.09Chlorophyll a-b binding protein 50, chloroplastic ... [more]
CB2A_SPIOL6.128e-11486.96Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB25_PETSP8.003e-11486.52Chlorophyll a-b binding protein 91R, chloroplastic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004261_H03 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IVF_H03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934227 ID=CK934227|Name=CK934227|organism=Citrus sinensis|type=EST|length=761bp
GGGGACAACCAACAGCCTTTCTTGCTTNNACAGCTTCTGTTGCTTACACA
GCTTCTGCTTCTCAATTAAATCCCTCAATGGCAACCTCGACCATGGGTCT
CTCCTCATCATTCGTCGGCAAGGCTGTGAACCTTGCCCCTTCAGGCAATG
ACCTGAGCAATGGTGGCCGCATCTCCATGCGTAAAACCGGGAGCAAGTCT
GTTTCTTCGGGTAGCCCGTGGTACGGCCCGGACAGAGTCAAGTACTTGGG
TCCATTCTCTGGCGAGCCCCCAAGCTACTTGACTGGTGAGTTCCCTGGTG
ACTACGGTTGGGACACTGCTGGGCTTTCAGCTGACCCAGAAACCTTTGCC
AAGAACCGTGAACTCGAAGTCATCCACTGCAGATGGGCCATGTTGGGAGC
TCTTGGATGCGTCTTCCCGGAGCTCTTGGCCCGCAACGGAGTCAAGTTCG
GTGAGGCCGTGTGGTTCAAGGCGGGGGCCCAGATCTTCAGCGAGGACGGG
CTTGACTACTTGGGGAACCCAAGCCTGATCCACGCTCAGAGCATCTTGGC
CATCTGGGCTTGCCTGGTGGTCTTGATGGGAGCCGTTGAGGGTTACAGAA
TTGCTGGAGGGCCGCTCGGTGAAGTGACTGACCCATTGTACCCAGGTGGC
AGCTTTGATCCATTGGGTTTGGCTGATGACCCGGAGGCTTTTGCTGAGCT
CAAGGTTAAGGAAATCAAGAATGGAAGGTTGGCTATGTTCTCCATGTTTG
GTTTCTTCGGT
back to top