CK934232

Overview
NameCK934232
Unique NameCK934232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK934232_ssr145 microsatellite CK934232_ssr145:145..159. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig9795 contig Csv1_Contig9795:39..912. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934232 vs. ExPASy Swiss-Prot
Match: CYSP_PEA (Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 3.138e-99
Identity = 173/228 (75.88%), Postives = 200/228 (87.72%), Query Frame = 1
Query:  193 NDDDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNRRLRLPADAQKAPILPTNDLPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAA 876
            N+DD +IRQVV ++    EDHLLNAEHHF+ FKSKFSK+YAT+EEHDYRF VFK+NL +AK  Q  DPTA HG+TKFSDLT SEFRRQFLGL +RLRLPA AQKAPILPT +LP DFDWR+ GAVT VKDQG+CGSCW+FS TGALEGAH+L+TG+LVSLSEQQLVDCDH CDPE++GSCDSGCNGGLMN+AFEY+L++GGV +EKDY YTG D GSCKFDKSK+ A+
Sbjct:   24 NNDDFIIRQVVDNE----EDHLLNAEHHFTSFKSKFSKSYATKEEHDYRFGVFKSNLIKAKLHQNRDPTAEHGITKFSDLTASEFRRQFLGLKKRLRLPAHAQKAPILPTTNLPEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGAHYLATGKLVSLSEQQLVDCDHVCDPEQAGSCDSGCNGGLMNNAFEYLLESGGVVQEKDYAYTGRD-GSCKFDKSKVVAS 246          
BLAST of CK934232 vs. ExPASy Swiss-Prot
Match: RD19A_ARATH (Cysteine proteinase RD19a OS=Arabidopsis thaliana GN=RD19A PE=2 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 8.843e-94
Identity = 164/226 (72.57%), Postives = 188/226 (83.19%), Query Frame = 1
Query:  199 DDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNRRLRLPADAQKAPILPTNDLPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAA 876
            DD +IRQVV      +E  +L +E HFSLFK KF K YA+ EEHDYRF VFKANLRRA+R Q LDP+A HGVT+FSDLT SEFR++ LG+    +LP DA KAPILPT +LP DFDWRDHGAVT VK+QG+CGSCWSFSATGALEGA+FL+TG+LVSLSEQQLVDCDHECDPEE+ SCDSGCNGGLMNSAFEY LK GG+ +E+DYPYTG DG +CK DKSKI A+
Sbjct:   29 DDLVIRQVVGG----AEPQVLTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRARRHQKLDPSATHGVTQFSDLTRSEFRKKHLGVRSGFKLPKDANKAPILPTENLPEDFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLVSLSEQQLVDCDHECDPEEADSCDSGCNGGLMNSAFEYTLKTGGLMKEEDYPYTGKDGKTCKLDKSKIVAS 250          
BLAST of CK934232 vs. ExPASy Swiss-Prot
Match: A494_ARATH (Probable cysteine proteinase A494 OS=Arabidopsis thaliana GN=At2g21430 PE=2 SV=2)

HSP 1 Score: 340.887 bits (873), Expect = 5.732e-93
Identity = 162/227 (71.37%), Postives = 188/227 (82.82%), Query Frame = 1
Query:  196 DDDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNRRLRLPADAQKAPILPTNDLPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAA 876
            D+D +IRQVV    +++E  +L++E HF+LFK KF K Y + EEH YRF VFKANL RA R Q +DP+A HGVT+FSDLT SEFRR+ LG+    +LP DA +APILPT +LP +FDWRD GAVT VK+QG+CGSCWSFS TGALEGAHFL+TG+LVSLSEQQLVDCDHECDPEE GSCDSGCNGGLMNSAFEY LK GG+ REKDYPYTGTDGGSCK D+SKI A+
Sbjct:   25 DEDVLIRQVV----DETEPKVLSSEDHFTLFKKKFGKVYGSIEEHYYRFSVFKANLLRAMRHQKMDPSARHGVTQFSDLTRSEFRRKHLGVKGGFKLPKDANQAPILPTQNLPEEFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGKLVSLSEQQLVDCDHECDPEEEGSCDSGCNGGLMNSAFEYTLKTGGLMREKDYPYTGTDGGSCKLDRSKIVAS 247          
BLAST of CK934232 vs. ExPASy Swiss-Prot
Match: CYSP1_MAIZE (Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 4.117e-83
Identity = 152/231 (65.80%), Postives = 176/231 (76.19%), Query Frame = 1
Query:  199 DDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNRRLR-----LPADAQKAPILPTNDLPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAAA 876
            +D +IRQVVP  G    D  LNAE HF  F  +F K+Y   +EH YR  VFK NLRRA+R QLLDP+A HGVTKFSDLTP+EFRR +LGL +  R     L   A +AP+LPT+ LP DFDWRDHGAV  VK+QG+CGSCWSFSA+GALEGAH+L+TG+L  LSEQQ VDCDHECD  E  SCDSGCNGGLM +AF Y+ KAGG+E EKDYPYTG+D G CKFDKSKI A+
Sbjct:   24 EDPLIRQVVP--GGDDNDLELNAESHFLSFVQRFGKSYKDADEHAYRLSVFKDNLRRARRHQLLDPSAEHGVTKFSDLTPAEFRRTYLGLRKSRRALLRELGESAHEAPVLPTDGLPDDFDWRDHGAVGPVKNQGSCGSCWSFSASGALEGAHYLATGKLEVLSEQQFVDCDHECDSSEPDSCDSGCNGGLMTTAFSYLQKAGGLESEKDYPYTGSD-GKCKFDKSKIVAS 251          
BLAST of CK934232 vs. ExPASy Swiss-Prot
Match: CYSP1_DICDI (Cysteine proteinase 1 OS=Dictyostelium discoideum GN=cprA PE=1 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 1.059e-46
Identity = 99/213 (46.48%), Postives = 128/213 (60.09%), Query Frame = 1
Query:  259 LNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLL----DPTAVHGVTKFSDLTPSEFRRQFLGLNRRLRLPADAQKAPILPT---NDLPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHEC-DPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAA 873
            L  +  F  F+ KF+K Y+  EE+  RF +FK+NL + +   L+          GV KF+DL+  EF+  +L  N+      D   A  L     N +PT FDWR  GAVT VK+QG CGSCWSFS TG +EG HF+S  +LVSLSEQ LVDCDHEC + E   +CD GCNGGL  +A+ YI+K GG++ E  YPYT   G  C F+ + I A
Sbjct:   23 LEEQSQFLEFQDKFNKKYS-HEEYLERFEIFKSNLGKIEELNLIAINHKADTKFGVNKFADLSSDEFKNYYLN-NKEAIFTDDLPVADYLDDEFINSIPTAFDWRTRGAVTPVKNQGQCGSCWSFSTTGNVEGQHFISQNKLVSLSEQNLVDCDHECMEYEGEQACDEGCNGGLQPNAYNYIIKNGGIQTESSYPYTAETGTQCNFNSANIGA 233          
BLAST of CK934232 vs. ExPASy Swiss-Prot
Match: CPR1_ARATH (Probable cysteine proteinase At3g19400 OS=Arabidopsis thaliana GN=At3g19400 PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 2.139e-39
Identity = 87/190 (45.79%), Postives = 121/190 (63.68%), Query Frame = 1
Query:  304 KTYATQEEHDYRFRVFKANLRRA-KRRQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNRRLRLPADAQKAP--ILPTND-LPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKS 861
            K Y    E + RF++FK NL+   +   + D T   G+T+F+DLT  EFR  +L   +++    D+ K    +    D LP + DWR +GAV  VKDQG CGSCW+FSA GA+EG + ++TGEL+SLSEQ+LVDCD        G  ++GC+GG+MN AFE+I+K GG+E ++DYPY   D G C  DK+
Sbjct:   53 KNYNGLGEKERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRFADLTNEEFRAIYL--RKKMERTKDSVKTERYLYKEGDVLPDEVDWRANGAVVSVKDQGNCGSCWAFSAVGAVEGINQITTGELISLSEQELVDCDR-------GFVNAGCDGGIMNYAFEFIMKNGGIETDQDYPYNANDLGLCNADKN 233          
BLAST of CK934232 vs. ExPASy Swiss-Prot
Match: CATL_SARPE (Cathepsin L OS=Sarcophaga peregrina PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.794e-39
Identity = 94/216 (43.52%), Postives = 122/216 (56.48%), Query Frame = 1
Query:  256 LLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRR-AKRRQLLDPTAVH---GVTKFSDLTPSEFRRQFLGLNRRLRLPADAQKAPILPTN------DLPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAA 873
            L+  E H   +K +  K YA + E  +R ++F  N  + AK  QL     V    G+ K++D+   EF+    G N  LR     +   +  T        +P   DWR+HGAVTGVKDQG CGSCW+FS+TGALEG HF   G LVSLSEQ LVDC  +         ++GCNGGLM++AF YI   GG++ EK YPY G D  SC F+K+ I A
Sbjct:   23 LIKEEWH--TYKLQHRKNYANEVEERFRMKIFNENRHKIAKHNQLFAQGKVSYKLGLNKYADMLHHEFKETMNGYNHTLRQLMRERTGLVGATYIPPAHVTVPKSVDWREHGAVTGVKDQGHCGSCWAFSSTGALEGQHFRKAGVLVSLSEQNLVDCSTKYG-------NNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEGID-DSCHFNKATIGA 228          
BLAST of CK934232 vs. ExPASy Swiss-Prot
Match: CATV_NPVAH (Viral cathepsin OS=Adoxophyes honmai nucleopolyhedrovirus GN=VCATH PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 1.062e-38
Identity = 89/237 (37.55%), Postives = 133/237 (56.12%), Query Frame = 1
Query:  208 MIRQVVPSDGEQSEDHLL----NAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNRRLRLPADAQK------------APILPTNDLPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIA 870
            MI  ++     Q E HL     +A+H+F  F   ++K Y   +  +YRF++FK NL     +  L+ +A++ + KFSDL+ +E   ++ GL  +   P++  +            AP    ++LP +FDWR +  +T VKDQGACGSCW+ +A G LE  + +    L++LSEQQL+DCD         S +  C+GGLM++AFE ++ AGG+  E DYPY GT  G CK D  K A
Sbjct:    5 MIFTILLVASSQIEGHLKFDIHDAQHYFETFIINYNKQYPDTKTKNYRFKIFKQNLEDINEKNKLNDSAIYNINKFSDLSKNELLTKYTGLTSKK--PSNMVRSTSNFCNVIHLDAPPDVHDELPQNFDWRVNNKMTSVKDQGACGSCWAHAAVGTLETLYAIKHNYLINLSEQQLIDCD---------SANMACDGGLMHTAFEQLMNAGGLMEEIDYPYQGTK-GVCKIDNKKFA 229          
BLAST of CK934232 vs. ExPASy Swiss-Prot
Match: CYSP2_DICDI (Cysteine proteinase 2 OS=Dictyostelium discoideum GN=cprB PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 5.269e-38
Identity = 88/203 (43.35%), Postives = 118/203 (58.13%), Query Frame = 1
Query:  277 FSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKR-RQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNRRLRLPADAQKAPILPTNDL---PTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTDGGSCKFDKSKIAA 873
            F+ +  KF++ Y++ E  + R+ +FK+N+          D   V G+  F+D+T  E+R+ +LG               +L   DL   P   DWR   AVT +KDQG CGSCWSFS TG+ EGAH L T +LVSLSEQ LVDC     PEE    + GC+GGLMN+AF+YI+K  G++ E  YPYT   G +C F+KS I A
Sbjct:   36 FTEWTLKFNRQYSSSEFSN-RYSIFKSNMDYVDNWNSKGDSQTVLGLNNFADITNEEYRKTYLGTRVNAHSYNGYDGREVLNVEDLQTNPKSIDWRTKNAVTPIKDQGQCGSCWSFSTTGSTEGAHALKTKKLVSLSEQNLVDCS---GPEE----NFGCDGGLMNNAFDYIIKNKGIDTESSYPYTAETGSTCLFNKSDIGA 230          
BLAST of CK934232 vs. ExPASy Swiss-Prot
Match: ORYA_ORYSJ (Oryzain alpha chain OS=Oryza sativa subsp. japonica GN=Os04g0650000 PE=1 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 8.988e-38
Identity = 85/209 (40.67%), Postives = 120/209 (57.42%), Query Frame = 1
Query:  223 VPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVH----GVTKFSDLTPSEFRRQFLGLNRRLRLPADAQKAPILPTND-LPTDFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLSTGELVSLSEQQLVDCDHECDPEESGSCDSGCNGGLMNSAFEYILKAGGVEREKDYPYTGTD 834
            + S GE+SE+    A   ++ +K++  K+Y    E + R+  F+ NLR            VH    G+ +F+DLT  E+R  +LGL  + R         +   N+ LP   DWR  GAV  +KDQG CGSCW+FSA  A+EG + + TG+L+SLSEQ+LVDCD         S + GCNGGLM+ AF++I+  GG++ E DYPY G D
Sbjct:   25 IVSYGERSEEE---ARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRFADLTNEEYRDTYLGLRNKPRRERKVSDRYLAADNEALPESVDWRTKGAVAEIKDQGGCGSCWAFSAIAAVEGINQIVTGDLISLSEQELVDCD--------TSYNEGCNGGLMDYAFDFIINNGGIDTEDDYPYKGKD 222          
The following BLAST results are available for this feature:
BLAST of CK934232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 154
Match NameE-valueIdentityDescription
CYSP_PEA3.138e-9975.88Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1[more]
RD19A_ARATH8.843e-9472.57Cysteine proteinase RD19a OS=Arabidopsis thaliana ... [more]
A494_ARATH5.732e-9371.37Probable cysteine proteinase A494 OS=Arabidopsis t... [more]
CYSP1_MAIZE4.117e-8365.80Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=... [more]
CYSP1_DICDI1.059e-4646.48Cysteine proteinase 1 OS=Dictyostelium discoideum ... [more]
CPR1_ARATH2.139e-3945.79Probable cysteine proteinase At3g19400 OS=Arabidop... [more]
CATL_SARPE2.794e-3943.52Cathepsin L OS=Sarcophaga peregrina PE=1 SV=1[more]
CATV_NPVAH1.062e-3837.55Viral cathepsin OS=Adoxophyes honmai nucleopolyhed... [more]
CYSP2_DICDI5.269e-3843.35Cysteine proteinase 2 OS=Dictyostelium discoideum ... [more]
ORYA_ORYSJ8.988e-3840.67Oryzain alpha chain OS=Oryza sativa subsp. japonic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004261_F10 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IVF_F10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934232 ID=CK934232|Name=CK934232|organism=Citrus sinensis|type=EST|length=878bp
GGGGGAGAAATTAGGTGTCGAAATCTCATACGCGGACCCAACCACAAGTT
TCTTCTGTCTTTTTGGAAACATTTATTATCTGCTTCATCCTGCTTTGCAG
TCCACTGGAACAAATCGAAAATGGAGCGCCTTATTCTCTCCTCTCTCCTC
CTCCTCCTCCTATCTTCTGTGCTTGCGTCCGCTGTAGCTGTCAACGACGA
CGATGCTATGATCAGACAGGTCGTGCCGTCAGACGGCGAACAATCCGAAG
ATCATCTCCTGAACGCGGAGCACCACTTCTCCCTCTTCAAGTCCAAATTC
TCCAAGACTTACGCCACCCAGGAGGAGCACGATTACCGATTCCGCGTGTT
CAAGGCTAATCTGCGCCGAGCAAAGCGACGCCAGCTCCTGGACCCCACTG
CTGTCCACGGTGTCACCAAGTTCTCCGACTTAACGCCGTCTGAATTCCGC
CGTCAGTTCCTTGGCTTGAATAGGCGGCTTCGGCTGCCAGCTGACGCTCA
AAAGGCTCCTATTCTCCCCACCAACGATCTTCCTACTGACTTTGACTGGC
GTGATCACGGCGCCGTTACTGGCGTCAAAGACCAGGGCGCATGTGGATCG
TGCTGGTCGTTTAGTGCAACCGGCGCTTTGGAGGGAGCGCACTTCTTATC
GACGGGCGAGCTTGTCAGCCTCAGTGAGCAACAGCTTGTGGACTGTGATC
ACGAGTGTGATCCAGAGGAATCTGGTTCATGTGACTCTGGGTGCAATGGT
GGGCTAATGAACTCTGCCTTTGAGTACATACTCAAGGCTGGTGGGGTTGA
GCGAGAGAAGGACTACCCTTACACTGGGACCGACGGTGGTTCCTGCAAAT
TTGACAAAAGCAAAATTGCTGCAGCTGT
back to top