CK934244

Overview
NameCK934244
Unique NameCK934244
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length783
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3615 contig Csv1_Contig3615:93..860. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934244 vs. ExPASy Swiss-Prot
Match: MOC2A_ARATH (Molybdenum cofactor synthesis protein 2A OS=Arabidopsis thaliana GN=At4g10100 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.086e-20
Identity = 47/75 (62.67%), Postives = 62/75 (82.67%), Query Frame = 1
Query:  229 SSIQIKVLFFARARDLTGLTDMPLEVSYGSTTQDCLNKLIARFPNLEEIRGCMVLALNEEYTNASVIVNEKDELA 453
            SS++IKVL FARAR+LTG+ D+ L++  GSTTQ CL++L+ +FP+LEE+R C+VLALNEEYT  S IV  +DELA
Sbjct:   14 SSVEIKVLLFARARELTGVPDLTLKMPSGSTTQKCLDELVLKFPSLEEVRSCVVLALNEEYTTDSAIVQHRDELA 88          
BLAST of CK934244 vs. ExPASy Swiss-Prot
Match: MOC2A_ORYSJ (Molybdenum cofactor synthesis protein 2A OS=Oryza sativa subsp. japonica GN=Os02g0558300 PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.734e-18
Identity = 46/86 (53.49%), Postives = 61/86 (70.93%), Query Frame = 1
Query:  196 NSDSALVDNKESSIQIKVLFFARARDLTGLTDMPLEVSYGSTTQDCLNKLIARFPNLEEIRGCMVLALNEEYTNASVIVNEKDELA 453
            ++D+      ++ +++KVLFFARARDLTG+T+ P+EV  GST  DCL +++A FP LEEIR  MVLALNEEY      V + DELA
Sbjct:   16 SADNPTAAAAKAKVKVKVLFFARARDLTGVTEAPVEVPAGSTAGDCLARVLAAFPRLEEIRRSMVLALNEEYAPEDAAVGDGDELA 101          
BLAST of CK934244 vs. ExPASy Swiss-Prot
Match: MOC2A_ORYSI (Molybdenum cofactor synthesis protein 2A OS=Oryza sativa subsp. indica GN=OsI_07667 PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.734e-18
Identity = 46/86 (53.49%), Postives = 61/86 (70.93%), Query Frame = 1
Query:  196 NSDSALVDNKESSIQIKVLFFARARDLTGLTDMPLEVSYGSTTQDCLNKLIARFPNLEEIRGCMVLALNEEYTNASVIVNEKDELA 453
            ++D+      ++ +++KVLFFARARDLTG+T+ P+EV  GST  DCL +++A FP LEEIR  MVLALNEEY      V + DELA
Sbjct:   16 SADNPTAAAAKAKVKVKVLFFARARDLTGVTEAPVEVPAGSTAGDCLARVLAAFPRLEEIRRSMVLALNEEYAPEDAAVGDGDELA 101          
BLAST of CK934244 vs. ExPASy Swiss-Prot
Match: MOC2A_MAIZE (Molybdenum cofactor synthesis protein 2A OS=Zea mays GN=VP15 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 9.516e-17
Identity = 44/71 (61.97%), Postives = 54/71 (76.06%), Query Frame = 1
Query:  241 IKVLFFARARDLTGLTDMPLEVSYGSTTQDCLNKLIARFPNLEEIRGCMVLALNEEYTNASVIVNEKDELA 453
            +KVLFFARARDLTG+ D  +EV  GST  +CL +++A+FP LEEIRG +VLALNEEY   S  V + DELA
Sbjct:   15 VKVLFFARARDLTGVADSAVEVPPGSTAGECLARVLAQFPKLEEIRGSVVLALNEEYAADSAAVADGDELA 85          
The following BLAST results are available for this feature:
BLAST of CK934244 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
MOC2A_ARATH1.086e-2062.67Molybdenum cofactor synthesis protein 2A OS=Arabid... [more]
MOC2A_ORYSJ1.734e-1853.49Molybdenum cofactor synthesis protein 2A OS=Oryza ... [more]
MOC2A_ORYSI1.734e-1853.49Molybdenum cofactor synthesis protein 2A OS=Oryza ... [more]
MOC2A_MAIZE9.516e-1761.97Molybdenum cofactor synthesis protein 2A OS=Zea ma... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004261_F04 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IVF_F04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934244 ID=CK934244|Name=CK934244|organism=Citrus sinensis|type=EST|length=783bp
GGGGACGTTATAATTTGTTTTTTATTTTTAATTCTCTCGTCGTCTTCTTT
TCCACAGCCCACCGTGCAAGTATTTTCGTACTTATCCCAGCACGGCGACC
TTCTATCCCTGTGCCAGGTAAGTCAGATGATGCATTTCCATTGACCCATG
TCTGGTTCTACGATGGATGTCACAGAAAGAGAAACTAAAACTGGGAATTC
GGATTCTGCACTTGTTGACAACAAGGAATCCTCTATTCAGATAAAGGTAT
TGTTCTTTGCTAGAGCTCGAGATTTAACTGGCTTGACCGATATGCCACTA
GAGGTGTCGTATGGTAGTACCACACAAGATTGCTTGAATAAGCTTATTGC
AAGGTTTCCGAACTTAGAAGAGATCCGAGGATGCATGGTTCTTGCTTTAA
ATGAGGAATACACAAATGCATCTGTGATTGTTAATGAAAAAGATGAATTA
GCCATTATACCTCCCATAAGTGGTGGCTAAATCTTTTCATCTATCCCAAC
AGAAAAGCCGTAAAGAAATTGTGGCTAAATATACATGTTGTATCTTGACA
AACATTGTCAGAAAGAGGTTTCATGAAAGACTGTAATGCAGCCAGTATAT
ATACTAGTGCTGGTTGTGTTTTGGCTTTCTTTTTCTTTTTGCAATTTCTC
CGTTGTTGCAGATGATTTAACTTGAATACAACCGTTCTGTGCTTGACACG
GGATATGCATGTACACTTAATAAGAATGTTTATCTCTAGAAATGAAAACT
TTGCCCAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top