CK934523

Overview
NameCK934523
Unique NameCK934523
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length879
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK934523 vs. ExPASy Swiss-Prot
Match: RH37_ARATH (DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2)

HSP 1 Score: 284.263 bits (726), Expect = 6.403e-76
Identity = 161/259 (62.16%), Postives = 176/259 (67.95%), Query Frame = 1
Query:  160 MSTSWADSVSASENAAPASFNTNSLP-RSTYVPPHLRNKQPASFEPPAPSREAHE-----PASGPRW-----------GGGPRPDFXXXXXXXXXXXXXXXXXXXXXXXXXX-VREVNPF-GDDIDAEQPFAEAENTGINFDAYEDIPVETSGENVPPPVNTFAEIDLGEELNLNIRRCKYVKPTPVQRHAIPISVAGRDLMACAQTGSGKTAAFCFPIISGIMREQYVQRPRGARTVYPLALILAPTRELSSQIHDEA 879
            MS SWAD V+ SEN    S N NS P R  YVPPHLRN+ PA+ EP AP           P SG RW           GGG R D                             REVNPF  DD + E  F E +NT INFDAYEDIP+ETSG+NVPPPVNTFAEIDLGE LNLNIRRCKYVKPTPVQRHAIPI + GRDLMACAQTGSGKTAAFCFPIISGIM++Q+VQRPRG+RTVYPLA+IL+PTREL+SQIHDEA
Sbjct:    1 MSASWAD-VADSENTGSGSSNQNSHPSRPAYVPPHLRNR-PAASEPVAPLPANDRVGYGGPPSGSRWAPGGSGVGVGGGGGYRADAGRPGSGSGYGGRGGGGWNNRSGGWDRREREVNPFENDDSEPEPAFTEQDNTVINFDAYEDIPIETSGDNVPPPVNTFAEIDLGEALNLNIRRCKYVKPTPVQRHAIPILLEGRDLMACAQTGSGKTAAFCFPIISGIMKDQHVQRPRGSRTVYPLAVILSPTRELASQIHDEA 257          
BLAST of CK934523 vs. ExPASy Swiss-Prot
Match: RH11_ARATH (DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=2 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 8.956e-70
Identity = 148/258 (57.36%), Postives = 167/258 (64.73%), Query Frame = 1
Query:  160 MSTSWADSVSASENAAPASFNTNSLPRSTYVPPHLRNKQPASFEPPAPSRE----AHEPASGPRW-----------GGGPRPD---FXXXXXXXXXXXXXXXXXXXXXXXXXXVREVNPFGDDIDAEQPFAEAENTGINFDAYEDIPVETSGENVPPPVNTFAEIDLGEELNLNIRRCKYVKPTPVQRHAIPISVAGRDLMACAQTGSGKTAAFCFPIISGIMREQYVQRPRGARTVYPLALILAPTRELSSQIHDEA 879
            MS SWAD V+ SE A   S       +  YVPPHLRN+       P P  +      +PA G RW           GGG R D                               REVNPFGDD + E  F E ENTGINFDAYEDIPVETSG +VPPPVNTFA+IDLG+ LNLNIRRCKYV+PTPVQRHAIPI +A RDLMACAQTGSGKTAAFCFPIISGIM++Q+V+RPRG+R VYP A+IL+PTREL+ QIHDEA
Sbjct:    1 MSASWAD-VADSEKAVSQS-------KPPYVPPHLRNRPSEPVAAPLPQNDHAGYGGQPA-GSRWAPPSSGGGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGGWDRREREVNPFGDDAELEPVFTEQENTGINFDAYEDIPVETSGGDVPPPVNTFADIDLGDALNLNIRRCKYVRPTPVQRHAIPILLAERDLMACAQTGSGKTAAFCFPIISGIMKDQHVERPRGSRAVYPFAVILSPTRELACQIHDEA 249          
BLAST of CK934523 vs. ExPASy Swiss-Prot
Match: RH52_ARATH (DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=2 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 3.763e-68
Identity = 143/243 (58.85%), Postives = 164/243 (67.49%), Query Frame = 1
Query:  163 STSWADSVSASENAAPASFNTNSLP-RSTYVPPHLRNKQPAS-FEPPAPSREAHEPASGPRWGGGPRPDFXXXXXXXXXXXXXXXXXXXXXXXXXXVR--EVNPFGDDIDAEQPFAEAENTGINFDAYEDIPVETSGENVPPPVNTFAEIDLGEELNLNIRRCKYVKPTPVQRHAIPISVAGRDLMACAQTGSGKTAAFCFPIISGIMREQYVQRPRGARTVYPLALILAPTRELSSQIHDEA 879
            S SWAD VS SE A        S P R+ YVPPHLR++ P+S F  P+P         G   G G R                              R  E NPFG+D +A+    E ENT INF+AYEDIP+ETSG+NVPPPVNTFAEIDLGE LNLNI+RCKYVKPTPVQR+AIPI  AGRDLMACAQTGSGKTAAFCFPIISGIM++Q+++RPRG R VYPLA+IL+PTREL+ QIHDEA
Sbjct:    3 SNSWAD-VSESERAPSGGGWGYSRPSRTNYVPPHLRSRTPSSEFVAPSPGNNDRGGYGGANSGYGGRGQGYGGRGSGYGGRGGPVGGWNARSGGWDRRDTETNPFGNDGNADPAVNEQENTVINFEAYEDIPIETSGDNVPPPVNTFAEIDLGEALNLNIQRCKYVKPTPVQRNAIPILAAGRDLMACAQTGSGKTAAFCFPIISGIMKDQHIERPRGVRGVYPLAVILSPTRELACQIHDEA 244          
BLAST of CK934523 vs. ExPASy Swiss-Prot
Match: RH52B_ORYSJ (DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.867e-67
Identity = 146/272 (53.68%), Postives = 169/272 (62.13%), Query Frame = 1
Query:  160 MSTSWADSVSASENAAPAS---FNTNSLPRSTYVPPHLRNKQPASFEPPAPSREAHEPAS---------------GPRWGG--------------GPRPDFXXXXXXXXXXXXXXXXXXXXXXXXXXVREVNPFGDDIDAEQPFAEAENTGINFDAYEDIPVETSGENVPPPVNTFAEIDLGEELNLNIRRCKYVKPTPVQRHAIPISVAGRDLMACAQTGSGKTAAFCFPIISGIMREQYVQRPRGARTVYPLALILAPTRELSSQIHDEA 879
            M +SWADS + +E +APA+      + LPRS+YVPPHLR +      P AP++    P++               GPRW G              G R  F                           RE +PF +   AE  F E ENTGINF+AYEDIPVETSG +VPPP NTFAEIDLG+ LN NIRRCKYVKPTPVQR+AIPIS+AGRDLMACAQTGSGKTAAFCFPIISGIMR +   R RG+RT YPLALIL+PTRELS QIH+EA
Sbjct:    1 MRSSWADSAANAEESAPAAAANHGNSRLPRSSYVPPHLRGQAA----PAAPAQAGALPSAAAAAQPSVGQPGVVGGPRWAGIVNGGGGGGGGSVGGSRQGFGAGGRGGGGGGGGGAWNSRPGGWDRRDREPDPFANSEAAEVDF-EGENTGINFEAYEDIPVETSGHDVPPPANTFAEIDLGDALNENIRRCKYVKPTPVQRYAIPISIAGRDLMACAQTGSGKTAAFCFPIISGIMRSRPPPRSRGSRTAYPLALILSPTRELSVQIHEEA 267          
BLAST of CK934523 vs. ExPASy Swiss-Prot
Match: RH37_ORYSJ (DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.210e-66
Identity = 149/276 (53.99%), Postives = 173/276 (62.68%), Query Frame = 1
Query:  160 MSTSWADSVSASENAAPASF--------NTNSLP-RSTYVPPHLRNKQPASFEPPAPSR--EAHEPAS------------GPRWGG-----------GPRPDFXXXXXXXXXXXXXXXXXXXXXXXXXXVREVNPFGDDI--DAEQPFAEAENTGINFDAYEDIPVETSGENVPPPVNTFAEIDLGEELNLNIRRCKYVKPTPVQRHAIPISVAGRDLMACAQTGSGKTAAFCFPIISGIMREQYVQRPRGARTVYPLALILAPTRELSSQIHDEA 879
            M +SWADSV+ +E +APA+         + NS P RS YVPPHLR + P +   PAP+    A +P++            G RW G           GPR                              RE NPF +    +A +   +  NTGINFDAYEDIPVETSG +VPPPVNTFAEIDLG+ LN NIRRCKYVKPTPVQR+AIPIS+AGRDLMACAQTGSGKTAAFCFPIISGIM  +  QRPRG+RT YPLALIL+PTRELS QIH+EA
Sbjct:    1 MRSSWADSVANAEESAPATGAAPTPVANHQNSRPTRSAYVPPHLRGQAPTTTAAPAPAPGPAAVQPSASVQPSGYAAIVGGSRWAGPASGDGTGAVGGPRQSVGGRGGGGGGGGGWNSRPGWDRRD----REPNPFANSEAEEATEVDFDTANTGINFDAYEDIPVETSGHDVPPPVNTFAEIDLGDALNENIRRCKYVKPTPVQRYAIPISIAGRDLMACAQTGSGKTAAFCFPIISGIMSSRPPQRPRGSRTAYPLALILSPTRELSVQIHEEA 272          
BLAST of CK934523 vs. ExPASy Swiss-Prot
Match: RH52C_ORYSJ (DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.809e-62
Identity = 144/254 (56.69%), Postives = 162/254 (63.78%), Query Frame = 1
Query:  166 TSWADSVSASENAAPA-SFNTNSLP-RSTYVPPHLRNKQPAS-----FEPPAPSREAHEPASGPRWGGGPRPDFXXXXXXXXXXXXXXXXXXXXXXXXXXVREVNPFGDDIDA-----EQP--FAEAENTGINFDAYEDIPVETSGENVPPPVNTFAEIDLGEELNLNIRRCKYVKPTPVQRHAIPISVAGRDLMACAQTGSGKTAAFCFPIISGIMREQYVQRPR--GARTVYPLALILAPTRELSSQIHDEA 879
            TSWAD   A    APA + N  + P RS+YVPPHLRN+  +S       PP+ S  +  P         PRP                             RE NPFG+D DA     ++P  F   +NTGINFDAYEDIPVETSG  VPPPV TFAEIDLG+ LN NIRRCKYV+PTPVQR+AIPIS+AGRDLMACAQTGSGKTAAFCFPIISGIMR    QRP+  G RT  PLALIL+PTRELS QIH+EA
Sbjct:    7 TSWADVADADPAPAPAPAANGPARPDRSSYVPPHLRNRGASSGGGAAAPPPSSSSSSAPPPRAAPGLLAPRPAAAGMGRMGGGGGGGGFGGPRRWD-----REPNPFGNDGDAAAGAGDEPEVFDAHQNTGINFDAYEDIPVETSGREVPPPVGTFAEIDLGQALNDNIRRCKYVRPTPVQRYAIPISLAGRDLMACAQTGSGKTAAFCFPIISGIMRGPPAQRPQRGGMRTACPLALILSPTRELSMQIHEEA 255          
BLAST of CK934523 vs. ExPASy Swiss-Prot
Match: DDX3_DROME (ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 7.162e-35
Identity = 73/129 (56.59%), Postives = 93/129 (72.09%), Query Frame = 1
Query:  508 NTGINFDAYEDIPVETSGENVPPPVNTFAEIDLGEELNLNIRRCKYVKPTPVQRHAIPISVAGRDLMACAQTGSGKTAAFCFPIISGIMREQYVQRPRGARTV-----YPLALILAPTRELSSQIHDEA 879
            NTGINFD YEDIPVE +G+NVPP + +F ++ L E +  N+   +Y KPTPVQ+HAIPI + GRDLMACAQTGSGKTAAF  PI++ +    +V  P+  R       YPL L+LAPTREL++QI +EA
Sbjct:  270 NTGINFDKYEDIPVEATGQNVPPNITSFDDVQLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPILNQMYELGHVPPPQSTRQYSRRKQYPLGLVLAPTRELATQIFEEA 398          
BLAST of CK934523 vs. ExPASy Swiss-Prot
Match: DED1_LODEL (ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus GN=DED1 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.764e-33
Identity = 101/277 (36.46%), Postives = 131/277 (47.29%), Query Frame = 1
Query:  178 DSVSASENAAPASFNTNSLP-----RSTYVPPHLRNKQPASFEPPAPSREAHEPASGPRW-----------------GGGPRPDFXXXXXXXXXXXXXXXXXXXXXXXXXXV-------REVNPFGDDIDAEQPFAEAENT-----GINFDAYEDIPVETSGENVPPPVNTFAEIDLGEELNLNIRRCKYVKPTPVQRHAIPISVAGRDLMACAQTGSGKTAAFCFPIISGIMREQYVQRPR---------GARTVYPLALILAPTRELSSQIHDEA 879
            +++S  +N  P     +  P     R  YVPPHLRN+  +S +P +       P  G R                  GGG  P                            V        E  P  D ++ E  F  AE+T     GINFD Y+DIPVE SGE VP P+N+F    L E L  NI+  ++ KPTPVQ++++PI  AGRDLMACAQTGSGKT  F FP++S    E Y+  P           +  VYP  L++APTREL SQI+DE+
Sbjct:    9 NNLSVQDNNKPNGNGYSGQPQQQSGRRQYVPPHLRNR--SSHQPSSNGANGDIPFGGSRRSDYGGGRGGFGFGGGSNGGGSGPSGGYRNGGARGGSRGGFGGGRYQRPTPGVGRWVDGKHEPAPRNDRLELEL-FGVAEDTLFQSSGINFDNYDDIPVEASGEGVPEPINSFTAPPLDELLVENIKLSRFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLS----ESYMNGPAPIPESTGAFSSHKVYPTILVMAPTRELVSQIYDES 278          
BLAST of CK934523 vs. ExPASy Swiss-Prot
Match: DDX3_XENLA (Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.764e-33
Identity = 73/148 (49.32%), Postives = 96/148 (64.86%), Query Frame = 1
Query:  460 PFGDDIDAEQPFAEAENTGINFDAYEDIPVETSGENVPPPVNTFAEIDLGEELNLNIRRCKYVKPTPVQRHAIPISVAGRDLMACAQTGSGKTAAFCFPIISGI--------MREQYVQRPRGARTVYPLALILAPTRELSSQIHDEA 879
            P   +   EQ      NTGINF+ Y+DIPVE +G N PP + +F ++ +GE +  NI+  +Y +PTPVQ+HAIPI +  RDLMACAQTGSGKTAAF  PI+S I        M+        G R  +PL+L+LAPTREL+ QI++EA
Sbjct:  180 PLAPNDRVEQELFSGSNTGINFEKYDDIPVEATGSNCPPHIESFHDVTMGEIIMGNIQLTRYTRPTPVQKHAIPIIIEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGDAMKHLQENGRYGRRKQFPLSLVLAPTRELAVQIYEEA 327          
BLAST of CK934523 vs. ExPASy Swiss-Prot
Match: DDX3Y_PONAB (ATP-dependent RNA helicase DDX3Y OS=Pongo abelii GN=DDX3Y PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 2.304e-33
Identity = 73/140 (52.14%), Postives = 94/140 (67.14%), Query Frame = 1
Query:  484 EQPFAEAENTGINFDAYEDIPVETSGENVPPPVNTFAEIDLGEELNLNIRRCKYVKPTPVQRHAIPISVAGRDLMACAQTGSGKTAAFCFPIISGIMREQYVQRPR--------GARTVYPLALILAPTRELSSQIHDEA 879
            EQ      NTGINF+ Y+DIPVE +G N PP +  F++ID+GE +  NI   +Y +PTPVQ+HAIPI    RDLMACAQTGSGKTAAF  PI+S I  +   +  +        G R  YP++L+LAPTREL+ QI++EA
Sbjct:  145 EQELFSGGNTGINFEKYDDIPVEATGSNCPPHIENFSDIDMGEIIMGNIELTRYTRPTPVQKHAIPIIKGKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEA 284          
The following BLAST results are available for this feature:
BLAST of CK934523 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 333
Match NameE-valueIdentityDescription
RH37_ARATH6.403e-7662.16DEAD-box ATP-dependent RNA helicase 37 OS=Arabidop... [more]
RH11_ARATH8.956e-7057.36DEAD-box ATP-dependent RNA helicase 11 OS=Arabidop... [more]
RH52_ARATH3.763e-6858.85DEAD-box ATP-dependent RNA helicase 52 OS=Arabidop... [more]
RH52B_ORYSJ1.867e-6753.68DEAD-box ATP-dependent RNA helicase 52B OS=Oryza s... [more]
RH37_ORYSJ1.210e-6653.99DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sa... [more]
RH52C_ORYSJ1.809e-6256.69DEAD-box ATP-dependent RNA helicase 52C OS=Oryza s... [more]
DDX3_DROME7.162e-3556.59ATP-dependent RNA helicase bel OS=Drosophila melan... [more]
DED1_LODEL1.764e-3336.46ATP-dependent RNA helicase DED1 OS=Lodderomyces el... [more]
DDX3_XENLA1.764e-3349.32Putative ATP-dependent RNA helicase an3 OS=Xenopus... [more]
DDX3Y_PONAB2.304e-3352.14ATP-dependent RNA helicase DDX3Y OS=Pongo abelii G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004258_A09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IF_A09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934523 ID=CK934523|Name=CK934523|organism=Citrus sinensis|type=EST|length=879bp
GCGGGGCACACGNNNAAACACCGCGAGCAACCNNNAGAAGAAGAAAAAAC
GAAGAAAGAGATTTGATTTTTGATCTGATTTTCAAACGAGGGGTTTTTGA
TCTGATAGTTAGATAGTTAGAAAGCAAACGAAAAATTTAGGGGGTAAAAT
TTTGCAATTATGAGCACATCATGGGCTGATTCAGTCTCTGCATCTGAGAA
TGCAGCCCCTGCTTCTTTTAACACCAATTCATTACCTCGATCCACTTATG
TTCCACCGCATCTCCGTAACAAGCAACCGGCCTCCTTTGAACCTCCTGCT
CCATCACGGGAAGCTCATGAACCTGCTAGTGGGCCCCGCTGGGGCGGTGG
TCCAAGGCCTGATTTTGGGCGTGGTCAGGGTTATGGTTCTGGTGGTAGAA
CTGGCGGTGGTTGGAATAATAGGAGTGGGGGGTGGGACCGAAGAGTACGT
GAAGTGAACCCGTTTGGTGATGACATTGATGCAGAGCAGCCGTTTGCTGA
AGCAGAAAACACGGGTATCAATTTTGATGCTTATGAGGATATTCCGGTGG
AGACGAGTGGGGAAAATGTGCCACCACCAGTTAATACATTTGCAGAAATA
GATCTGGGGGAAGAATTGAATCTTAATATTAGAAGGTGCAAGTACGTCAA
ACCCACCCCAGTTCAGCGTCATGCAATTCCTATATCGGTTGCTGGACGAG
ATTTAATGGCCTGTGCTCAGACAGGGTCGGGGAAGACAGCTGCCTTTTGT
TTTCCAATTATTAGTGGGATAATGCGTGAGCAGTATGTACAGAGACCACG
TGGAGCACGGACTGTTTATCCTCTGGCTCTTATTCTCGCCCCTACGAGAG
AACTCTCATCTCAGATACATGATGAAGCC
back to top