EY659809

Overview
NameEY659809
Unique NameEY659809
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length660
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7509 contig Csv1_Contig7509:1..662. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659809 vs. ExPASy Swiss-Prot
Match: TRPX_ARATH (Anthranilate synthase component I-2, chloroplastic OS=Arabidopsis thaliana GN=ASA2 PE=2 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 1.383e-89
Identity = 155/183 (84.70%), Postives = 166/183 (90.71%), Query Frame = 3
Query:    9 GSIKLHTRHFGPKLESSSMTSEAYKEAVLQAEEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKRKITNRPLAGTVRRGKTPKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVXESGSVNVEKLMNIEHYSHAMHISSTVTGELLDHL 557
            G IKL T+ FGPKLE S+MTSEAYKEAV++A+EHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYM YLQ RGCILVASSPEIL R K RKITNRPLAGTVRRGKTPKEDL+ EKELL+DEKQCAEHIMLVDLGRNDVGKV + GSV V+KL +IE +SH MHISSTV GELLDHL
Sbjct:  299 GFIKLRTQLFGPKLEKSTMTSEAYKEAVVEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMAYLQVRGCILVASSPEILLRSKNRKITNRPLAGTVRRGKTPKEDLMLEKELLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVKKLKDIEWFSHVMHISSTVVGELLDHL 481          

HSP 2 Score: 42.743 bits (99), Expect = 1.383e-89
Identity = 19/22 (86.36%), Postives = 20/22 (90.91%), Query Frame = 2
Query:  557 TSWDALRAALPVGTXSGAPQVK 622
            TSWDALRA LPVGT SGAP+VK
Sbjct:  482 TSWDALRAVLPVGTVSGAPKVK 503          

HSP 3 Score: 23.483 bits (49), Expect = 1.383e-89
Identity = 10/12 (83.33%), Postives = 12/12 (100.00%), Query Frame = 1
Query:  619 EAMELMDELEVT 654
            +AMEL+DELEVT
Sbjct:  503 KAMELIDELEVT 514          
BLAST of EY659809 vs. ExPASy Swiss-Prot
Match: TRPE_ARATH (Anthranilate synthase component I-1, chloroplastic OS=Arabidopsis thaliana GN=ASA1 PE=2 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 3.505e-82
Identity = 143/183 (78.14%), Postives = 159/183 (86.89%), Query Frame = 3
Query:    9 GSIKLHTRHFGPKLESSSMTSEAYKEAVLQAEEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKRKITNRPLAGTVRRGKTPKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVXESGSVNVEKLMNIEHYSHAMHISSTVTGELLDHL 557
            G++ L TR FGP L++S++T E YKEAV++A+EHILAGDIFQIVLSQRFERRTFADPFE+YRALR+VNPSPYM YLQARGCILVASSPEILT+VK+ KI NRPLAGT +RGK   ED   EKELL +EKQCAEHIMLVDLGRNDVGKV + GSV VEKLMNIE YSH MHISSTVTGEL D L
Sbjct:  286 GNVNLQTRQFGPSLDNSNVTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMGYLQARGCILVASSPEILTKVKQNKIVNRPLAGTSKRGKNEVEDKRLEKELLENEKQCAEHIMLVDLGRNDVGKVTKYGSVKVEKLMNIERYSHVMHISSTVTGELQDGL 468          

HSP 2 Score: 40.817 bits (94), Expect = 3.505e-82
Identity = 18/22 (81.82%), Postives = 19/22 (86.36%), Query Frame = 2
Query:  557 TSWDALRAALPVGTXSGAPQVK 622
            T WD LRAALPVGT SGAP+VK
Sbjct:  469 TCWDVLRAALPVGTVSGAPKVK 490          
BLAST of EY659809 vs. ExPASy Swiss-Prot
Match: TRPE_THEMA (Anthranilate synthase component 1 OS=Thermotoga maritima GN=trpE PE=3 SV=2)

HSP 1 Score: 184.882 bits (468), Expect = 2.931e-47
Identity = 92/165 (55.76%), Postives = 123/165 (74.55%), Query Frame = 3
Query:   57 SSMTSEAYKEAVLQAEEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKRKITNRPLAGTVRRGKTPKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVXESGSVNVEKLMNIEHYSHAMHISSTVTGELLD 551
            S+   E + + V +A+++I+ GDIFQ+VLSQ F  +T  DPF IYRALR++NPSPYM YL+    +++ SSPE + +V+  K T +P+AGT  RG+T +EDL  E+ELLNDEK+ AEH+MLVDLGRND+G+V + G+V VEK M IE YSH MHI S V+GEL D
Sbjct:  180 SNFEREQFYKVVEKAKKYIVEGDIFQVVLSQAFTFKTTLDPFYIYRALRMINPSPYMFYLKFGDTVVLGSSPETMAKVEGDKATVKPIAGTRPRGRTVEEDLKLERELLNDEKEIAEHVMLVDLGRNDLGRVCKEGTVRVEKKMVIERYSHVMHIVSQVSGELKD 344          

HSP 2 Score: 25.7942 bits (55), Expect = 2.931e-47
Identity = 10/19 (52.63%), Postives = 12/19 (63.16%), Query Frame = 2
Query:  566 DALRAALPVGTXSGAPQVK 622
            D   A  P GT SGAP+V+
Sbjct:  350 DVFEATFPAGTVSGAPKVR 368          
BLAST of EY659809 vs. ExPASy Swiss-Prot
Match: TRPE_CLOTM (Anthranilate synthase component 1 OS=Clostridium thermocellum GN=trpE PE=3 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.101e-46
Identity = 87/164 (53.05%), Postives = 122/164 (74.39%), Query Frame = 3
Query:   54 SSSMTSEAYKEAVLQAEEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKRKITNRPLAGTVRRGKTPKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVXESGSVNVEKLMNIEHYSHAMHISSTVTGEL 545
            +S+++ E +   VL+A+++I  GDIFQ+VLSQR    T  +PF IYRALR++NPSPYM YL+  G  ++ SSPE+L RV+   +   P+AGT +RG+T +ED   EKELL+DEK+ AEH+MLVDLGRND+G+V + G+V V+ LM+IE YSH MH+ + V GE+
Sbjct:  221 TSNISKEDFCRNVLKAKQYIRDGDIFQVVLSQRLCVETNENPFNIYRALRVINPSPYMYYLKFGGYRIIGSSPEMLVRVENGIVETCPIAGTRKRGRTKEEDEALEKELLSDEKEIAEHVMLVDLGRNDIGRVSKFGTVAVKNLMHIERYSHVMHVVTNVQGEI 384          

HSP 2 Score: 30.4166 bits (67), Expect = 1.101e-46
Identity = 13/22 (59.09%), Postives = 17/22 (77.27%), Query Frame = 2
Query:  557 TSWDALRAALPVGTXSGAPQVK 622
            T +DAL + LP GT SGAP+V+
Sbjct:  389 TPFDALMSILPAGTLSGAPKVR 410          
BLAST of EY659809 vs. ExPASy Swiss-Prot
Match: TRPE_AQUAE (Anthranilate synthase component 1 OS=Aquifex aeolicus GN=trpE PE=3 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.396e-46
Identity = 87/163 (53.37%), Postives = 118/163 (72.39%), Query Frame = 3
Query:   57 SSMTSEAYKEAVLQAEEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKRKITNRPLAGTVRRGKTPKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVXESGSVNVEKLMNIEHYSHAMHISSTVTGEL 545
            S+ T E +++ V +A+E+I  GD+ Q+VLSQRF +R   +P  IYR LR +NPSPYM YL      ++ SSPEIL R+++ +I  RP+AGT +RG+T +ED   E++LL+DEK+ AEH+MLVDL RND+G+V ++GSV VE  M IE YSH MHI S V GEL
Sbjct:  220 SNFTKEEFEDIVKKAKEYIAQGDVIQVVLSQRFRKRFKGNPDNIYRVLRFLNPSPYMYYLDFDQLKVIGSSPEILVRLEEGRIETRPIAGTRKRGRTEEEDKRLEEDLLSDEKERAEHLMLVDLARNDIGRVAKTGSVRVENFMRIERYSHVMHIVSDVVGEL 382          

HSP 2 Score: 28.4906 bits (62), Expect = 5.396e-46
Identity = 11/23 (47.83%), Postives = 16/23 (69.57%), Query Frame = 2
Query:  554 FTSWDALRAALPVGTXSGAPQVK 622
            + + D L+A  P GT SGAP+V+
Sbjct:  386 YDALDVLKATFPAGTVSGAPKVR 408          
BLAST of EY659809 vs. ExPASy Swiss-Prot
Match: TRPE_STRCO (Anthranilate synthase component 1 OS=Streptomyces coelicolor GN=trpE PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.865e-44
Identity = 86/167 (51.50%), Postives = 114/167 (68.26%), Query Frame = 3
Query:   54 SSSMTSEAYKEAVLQAEEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQ-ARGCILVASSPEILTRVKKRKITNRPLAGTVRRGKTPKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVXESGSVNVEKLMNIEHYSHAMHISSTVTGELLD 551
            ++++T   + E V +A EHI AGD FQIVLS+R  R   A P ++YR LR  NPSPYM +L    G  ++ +SPE+L + + R +  RPLAGT  R   P EDL  E+EL  DEK+ AEH+MLVDLGRND+G+V E G+V VE+LM +E +SH MH+SSTV G L +
Sbjct:  237 TANLTEAQFTERVARAREHIAAGDAFQIVLSRRLSRPLRARPTDLYRHLRATNPSPYMYHLSLGGGRHVIGASPELLVKAEGRTVRTRPLAGTRPRHPDPAEDLRLERELRADEKERAEHVMLVDLGRNDLGRVTEPGTVRVERLMRVERFSHVMHLSSTVRGRLAE 403          

HSP 2 Score: 32.7278 bits (73), Expect = 2.865e-44
Identity = 14/28 (50.00%), Postives = 20/28 (71.43%), Query Frame = 2
Query:  539 RVARSFTSWDALRAALPVGTXSGAPQVK 622
            R+A    + DALR+A P GT SGAP+++
Sbjct:  400 RLAEGRDALDALRSAFPAGTLSGAPKIR 427          
BLAST of EY659809 vs. ExPASy Swiss-Prot
Match: TRPE_SYNY3 (Probable anthranilate synthase component 1 OS=Synechocystis sp. (strain PCC 6803) GN=trpE PE=3 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 8.262e-44
Identity = 87/169 (51.48%), Postives = 112/169 (66.27%), Query Frame = 3
Query:   54 SSSMTSEAYKEAVLQAEEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKR-----KITNRPLAGTVRRGKTPKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVXESGSVNVEKLMNIEHYSHAMHISSTVTGEL 545
            SS+   E + E V  A+++I AGDIFQ+VLSQR       DPF++YR+LR++NPSPYM Y       ++ SSPE++ +  ++       T RP+AGT  RGKT  ED    +ELLND K+ AEH+MLVDLGRND+G+V   GSV V +LM IE YSH MHI S V GEL
Sbjct:  228 SSNTEQEKFLEEVAIAKDYITAGDIFQVVLSQRLSTIYRDDPFKLYRSLRLINPSPYMAYYNFGHWQIIGSSPEVMVKADRQLDGKLMATVRPIAGTRPRGKTHPEDEQLAEELLNDPKEIAEHVMLVDLGRNDLGRVCVQGSVKVNELMVIERYSHVMHIVSNVVGEL 396          

HSP 2 Score: 34.2686 bits (77), Expect = 8.262e-44
Identity = 13/27 (48.15%), Postives = 19/27 (70.37%), Query Frame = 2
Query:  542 VARSFTSWDALRAALPVGTXSGAPQVK 622
            +A   T+WD L+A  P GT SGAP+++
Sbjct:  396 LASDKTAWDLLKACFPAGTVSGAPKIR 422          
BLAST of EY659809 vs. ExPASy Swiss-Prot
Match: TRPE_THET8 (Anthranilate synthase component 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=trpE PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 4.049e-43
Identity = 85/165 (51.52%), Postives = 112/165 (67.88%), Query Frame = 3
Query:   57 SSMTSEAYKEAVLQAEEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKRKITNRPLAGTVRRGKTPKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVXESGSVNVEKLMNIEHYSHAMHISSTVTGELLD 551
            +  + EAY EAV +A ++I AGDIFQ+VLS R        PF +YRALR VNPSPYM YL     +LV++SPE L R   R++  RP+AGT  RGK  +ED    +ELL DEK+ AEH+ML+DL RND+G+V   G+V V + +++EHYSH MH+ STV G L +
Sbjct:  190 ADFSREAYLEAVRRALDYIRAGDIFQVVLSLRLSSPLTVHPFALYRALRSVNPSPYMGYLDLGEVVLVSASPESLLRSDGRRVVTRPIAGTRPRGKDEEEDKRLAEELLRDEKEVAEHVMLLDLSRNDIGRVAAFGTVRVLEPLHVEHYSHVMHLVSTVEGILAE 354          

HSP 2 Score: 30.4166 bits (67), Expect = 4.049e-43
Identity = 13/27 (48.15%), Postives = 19/27 (70.37%), Query Frame = 2
Query:  542 VARSFTSWDALRAALPVGTXSGAPQVK 622
            +A   T  DAL + LP+GT SGAP+++
Sbjct:  352 LAEGKTPLDALASVLPMGTVSGAPKIR 378          
BLAST of EY659809 vs. ExPASy Swiss-Prot
Match: TRPE_METJA (Anthranilate synthase component 1 OS=Methanocaldococcus jannaschii GN=trpE PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 8.957e-43
Identity = 90/171 (52.63%), Postives = 117/171 (68.42%), Query Frame = 3
Query:   57 SSMTSEAYKEAVLQAEEHILAGDIFQIVLSQRFE-RRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRV----KKRKITNRPLAGTVRRGKTPKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVXESGSVNVEKLMNIEHYSHAMHISSTVTGELLDH 554
            S+M+ E + EAV +A+E+I AGDIFQ+VLS+R E      D  +IY+ +R +NPSPYM YL      ++ SSPEIL R      KR +  RP+AGT+RRGKT +ED   EK+LL+DEK+ AEH+MLVDL RND+GK+ + G+V V   M IE YSH  HI S V GEL D+
Sbjct:  199 SNMSKEEFIEAVKKAKEYIFAGDIFQVVLSRRIEIDLDNLDHLKIYKKVREINPSPYMYYLDFGDRKIIGSSPEILVRTDYKDNKRLVITRPIAGTIRRGKTEEEDKELEKKLLSDEKERAEHVMLVDLARNDIGKISKFGTVEVTDFMIIEKYSHVQHIVSNVVGELKDN 369          

HSP 2 Score: 27.7202 bits (60), Expect = 8.957e-43
Identity = 11/24 (45.83%), Postives = 18/24 (75.00%), Query Frame = 2
Query:  551 SFTSWDALRAALPVGTXSGAPQVK 622
            ++ S+ A++A  P GT SGAP+V+
Sbjct:  369 NYDSFLAVKATFPAGTLSGAPKVR 392          
BLAST of EY659809 vs. ExPASy Swiss-Prot
Match: TRPE_PSESS (Anthranilate synthase component 1 OS=Pseudomonas syringae pv. savastanoi GN=trpE PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 2.581e-42
Identity = 85/169 (50.30%), Postives = 113/169 (66.86%), Query Frame = 3
Query:   57 SSMTSEAYKEAVLQAEEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKRKITNRPLAGTVRRGKTPKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVXESGSVNVEKLMNIEHYSHAMHISSTVTGELLDHLLA 563
            SS T   Y+ AV   +++ILAGD+ Q+V SQR      A P ++YRALR  NP+PYM +       +V SSPE+L RV+   IT RP+AGT  RG T + DL  E++LL+D K+ AEH+ML+DLGRNDVG+V E G+V + + M IE YS+ MHI S VTG+L + L A
Sbjct:  219 SSFTQGDYEAAVDTIKQYILAGDVMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDNLITVRPIAGTRPRGATEEADLALEEDLLSDHKEIAEHLMLIDLGRNDVGRVSEIGTVKLTEKMVIERYSNVMHIVSNVTGQLKNGLTA 387          

HSP 2 Score: 33.8834 bits (76), Expect = 2.581e-42
Identity = 14/28 (50.00%), Postives = 20/28 (71.43%), Query Frame = 2
Query:  539 RVARSFTSWDALRAALPVGTXSGAPQVK 622
            ++    T+ DALRA LP GT SGAP+++
Sbjct:  380 QLKNGLTAMDALRAILPAGTLSGAPKIR 407          
The following BLAST results are available for this feature:
BLAST of EY659809 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
TRPX_ARATH1.383e-8984.70Anthranilate synthase component I-2, chloroplastic... [more]
TRPE_ARATH3.505e-8278.14Anthranilate synthase component I-1, chloroplastic... [more]
TRPE_THEMA2.931e-4755.76Anthranilate synthase component 1 OS=Thermotoga ma... [more]
TRPE_CLOTM1.101e-4653.05Anthranilate synthase component 1 OS=Clostridium t... [more]
TRPE_AQUAE5.396e-4653.37Anthranilate synthase component 1 OS=Aquifex aeoli... [more]
TRPE_STRCO2.865e-4451.50Anthranilate synthase component 1 OS=Streptomyces ... [more]
TRPE_SYNY38.262e-4451.48Probable anthranilate synthase component 1 OS=Syne... [more]
TRPE_THET84.049e-4351.52Anthranilate synthase component 1 OS=Thermus therm... [more]
TRPE_METJA8.957e-4352.63Anthranilate synthase component 1 OS=Methanocaldoc... [more]
TRPE_PSESS2.581e-4250.30Anthranilate synthase component 1 OS=Pseudomonas s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-015-C11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659809 ID=EY659809|Name=EY659809|organism=Citrus sinensis|type=EST|length=660bp
TCCGCAAAGGTTCAATAAAGTTACACACTCGCCATTTTGGTCCTAAATTG
GAGAGTTCAAGCATGACAAGTGAAGCATATAAGGAGGCTGTATTGCAGGC
CGAGGAGCATATCCTTGCTGGTGACATTTTCCAGATTGTATTAAGTCAGC
GTTTTGAAAGGCGAACTTTTGCAGACCCATTTGAAATCTACAGAGCACTG
AGGATTGTCAATCCAAGTCCATACATGACTTATTTGCAAGCTAGAGGGTG
TATACTGGTTGCTTCTAGTCCAGAAATTCTTACACGTGTGAAGAAGAGAA
AGATTACTAATCGACCCCTTGCTGGCACTGTTAGAAGAGGCAAGACACCT
AAAGAAGATCTAGTGTTTGAGAAGGAGCTTTTGAATGATGAAAAGCAATG
TGCAGAGCACATTATGCTTGTTGACTTGGGGAGGAATGATGTTGGAAAGG
TTTNCGAATCTGGNTCTGTGAACGTTGAAAAGCTCATGAATATTGAACAT
TATTCTCATGCTATGCACATAAGCTCGACGGTAACTGGCGAGTTGCTCGA
TCATTTACTAGCTGGGATGCGTTGCGTGCAGCACTACCTGTTGGGACCGN
TAGTGGAGCACCCCAGGTGAAGCCATGGAGTTGATGGATGAGCTGGAAGT
CACAGGCGCG
back to top