EY659723

Overview
NameEY659723
Unique NameEY659723
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length912
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659723_ssr25 microsatellite EY659723_ssr25:25..36. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659723 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 6.718e-100
Identity = 191/278 (68.71%), Postives = 209/278 (75.18%), Query Frame = 3
Query:   87 IGVKEMLGNPLNVSSAVRTSAPGASNPSTFKPVALFXXXXXXXXXXXXXXXXXXXNEELAKWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVFAVIAEIVLVXGAEYYRITNGLDFGDKLHPGGPFDPLGLAXGS*QFALLKXKEIRMGDLPWFACLGSF-SRLCHSEGQVRT-C*HLSDPFATTA*R-ISGTKKAPP 911
            +GV EMLG PLN  +  R+SAP AS+PSTFK VALF                   ++ELAKWYGPDRRIFLP+GLLDRSEIPEYL GEV GDYGYDPFGL KKP++F+KYQA+ELIHARWAMLGAAGFIIPEA NK+GANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLV AV+AE+VL+ GAEYYRITNGLDF DKLHPGGPFDPLGLA    Q ALLK KEI+ G L  FA LG F       EG V     HLSDPF       I+GT +  P
Sbjct:    4 LGVSEMLGTPLNFRAVSRSSAPLASSPSTFKTVALFSKKKPAPAKSKAVSET---SDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAGTAERAP 278          
BLAST of EY659723 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 2.685e-40
Identity = 100/223 (44.84%), Postives = 128/223 (57.40%), Query Frame = 3
Query:  267 KWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPI---NLVFAVIAEIVLVXGAEYYRITNG----LDFGDKLHPGGPFDPLGLAXGS*QFALLKXKEIRMGDLPWFACLGSF-SRLCHSEGQVRT-C*HLSDPFATTA*RISGTKKAP 908
            ++YGPDR  FL  G    ++ PEYLTGE PGDYG+D  GLS  P  F++Y+  ELIHARWA+LGA G + PE  +++      E VWFK GA +     LNY G    I   +++  +  ++VL+  AE YR   G    LD  D L+PGGPFDPLGLA     FA LK KEI+ G L  F+CLG F   +   +G V+    HL+DP    A   S TK  P
Sbjct:   32 EFYGPDRAKFL--GPFSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARYREIELIHARWALLGALGILTPELLSQYAGVQFGEPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVLMGLAEAYRANGGSEGFLDDLDTLYPGGPFDPLGLADDPDTFAELKVKEIKNGRLAMFSCLGFFVQAIVTGKGPVQNLTDHLADPTVNKA-FASATKFTP 251          
BLAST of EY659723 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 5.794e-35
Identity = 93/210 (44.29%), Postives = 119/210 (56.67%), Query Frame = 3
Query:  270 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVXGAEYYRITNG-LDFG-DKLHPGGPFDPLGLAXGS*QFALLKXKEIRMGDLPWFACLGSF-SRLCHSEGQVRTC-*HLSDPFATTA 878
            WYGPDR  +L        +IP YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE  +K G   G EAVWFK G+ +     L+Y G    I    + A+ A ++VL+   E YR+  G L  G D ++PGG FDPLGLA     FA LK KEI+ G L  F+  G F   +   +G +     HL+DP A  A
Sbjct:   49 WYGPDRPKYLGPF---SDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANNA 254          
BLAST of EY659723 vs. ExPASy Swiss-Prot
Match: CB2_CHLMO (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas moewusii PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 7.567e-35
Identity = 88/211 (41.71%), Postives = 116/211 (54.98%), Query Frame = 3
Query:  267 KWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPI---NLVFAVIAEIVLVXGAEYYRITNGL--DFGDKLHPGGPFDPLGLAXGS*QFALLKXKEIRMGDLPWFACLGSF-SRLCHSEGQVRT-C*HLSDPFATTA 878
            +WYGPDR  +L       +  P YLTGE PGDYG+D  GLS  P+ F KY+  E+IHARWA+LGA G + PE  + +      E VWFK GA +     L+Y G    I   N+V  +  ++VL+   E YR+  G   +  D L+PG  FDPLGLA     FA LK KEI+ G L  F+C G F   +   +G ++    HL+DP    A
Sbjct:   38 EWYGPDRAKWLGPF---STNTPAYLTGEFPGDYGWDTAGLSADPETFKKYRELEVIHARWALLGALGILTPELLSTYAGVKFGEPVWFKAGAQIFSEGGLDYLGSPALIHAQNIVATLAVQVVLMGLIEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFAELKVKEIKNGRLAMFSCFGFFVQAIVTGKGPIQNLADHLADPGTNNA 245          
BLAST of EY659723 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 7.567e-35
Identity = 89/210 (42.38%), Postives = 117/210 (55.71%), Query Frame = 3
Query:  270 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVXGAEYYRITNGL--DFGDKLHPGGPFDPLGLAXGS*QFALLKXKEIRMGDLPWFACLGSF-SRLCHSEGQVRT-C*HLSDPFATTA 878
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P++F+K +  E+IH RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G    +    + A+ A +++L+   E YRI  G   +  D ++PGG FDPLGLA     FA LK KEI+ G L  F+  G F   +   +G +     HL+DP    A
Sbjct:   58 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNA 263          
BLAST of EY659723 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.291e-34
Identity = 90/210 (42.86%), Postives = 117/210 (55.71%), Query Frame = 3
Query:  270 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVXGAEYYRITNGL--DFGDKLHPGGPFDPLGLAXGS*QFALLKXKEIRMGDLPWFACLGSF-SRLCHSEGQVRT-C*HLSDPFATTA 878
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ FSK +  E+IH+RWAMLGA G + PE  ++ G   G EAVWFK G+ +     L+Y G    +    + A+ A +++L+   E YRI  G   +  D L+PGG FDPLGLA     FA LK KE++ G L  F+  G F   +   +G +     HLSDP    A
Sbjct:   52 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNA 257          
BLAST of EY659723 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.686e-34
Identity = 89/210 (42.38%), Postives = 118/210 (56.19%), Query Frame = 3
Query:  270 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG--KNIPINLVFAVIA-EIVLVXGAEYYRITNGL--DFGDKLHPGGPFDPLGLAXGS*QFALLKXKEIRMGDLPWFACLGSF-SRLCHSEGQVRT-C*HLSDPFATTA 878
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G  + I    + A+ A +++L+   E YR+  G   +  D ++PGG FDPLGLA     FA LK KEI+ G L  F+  G F   +   +G +     HL+DP    A
Sbjct:   62 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNA 267          
BLAST of EY659723 vs. ExPASy Swiss-Prot
Match: CB24_PETSP (Chlorophyll a-b binding protein 25, chloroplastic OS=Petunia sp. GN=CAB25 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.202e-34
Identity = 90/210 (42.86%), Postives = 116/210 (55.24%), Query Frame = 3
Query:  270 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVXGAEYYRITNGL--DFGDKLHPGGPFDPLGLAXGS*QFALLKXKEIRMGDLPWFACLGSF-SRLCHSEGQVRT-C*HLSDPFATTA 878
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE F + G   G EAVWFK G+ +     L+Y G    +    + A+ A ++VL+   E YR+  G   +  D L+PGG FDPLGLA     FA LK KEI+ G L  F+  G F   +   +G +     HL+DP    A
Sbjct:   50 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNA 255          
BLAST of EY659723 vs. ExPASy Swiss-Prot
Match: CB23_ORYSJ (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. japonica GN=RCABP89 PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.202e-34
Identity = 93/213 (43.66%), Postives = 122/213 (57.28%), Query Frame = 3
Query:  270 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVFA--VIA----EIVLVXGAEYYRITNG-LDFG-DKLHPGGPFDPLGLAXGS*QFALLKXKEIRMGDLPWFACLGSF-SRLCHSEGQVRTC-*HLSDPFATTA 878
            WYGPDR  +L        + P YLTGE PGDYG+D  GLS  P+ F++ +  E+IH+RWAMLGA G + PE  +K G   G EAVWFK GA +     L+Y G     NLV A  ++A    ++VL+   E YR+  G L  G DK++PGG FDPLGLA     FA LK KE++ G L  F+  G F   +   +G +     H++DP A  A
Sbjct:   47 WYGPDRPKYLGPF---SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFG-EAVWFKAGAQIFSEGGLDYLGNP---NLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNA 252          
BLAST of EY659723 vs. ExPASy Swiss-Prot
Match: CB23_ORYSI (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_012078 PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.202e-34
Identity = 93/213 (43.66%), Postives = 122/213 (57.28%), Query Frame = 3
Query:  270 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVFA--VIA----EIVLVXGAEYYRITNG-LDFG-DKLHPGGPFDPLGLAXGS*QFALLKXKEIRMGDLPWFACLGSF-SRLCHSEGQVRTC-*HLSDPFATTA 878
            WYGPDR  +L        + P YLTGE PGDYG+D  GLS  P+ F++ +  E+IH+RWAMLGA G + PE  +K G   G EAVWFK GA +     L+Y G     NLV A  ++A    ++VL+   E YR+  G L  G DK++PGG FDPLGLA     FA LK KE++ G L  F+  G F   +   +G +     H++DP A  A
Sbjct:   47 WYGPDRPKYLGPF---SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFG-EAVWFKAGAQIFSEGGLDYLGNP---NLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNA 252          
The following BLAST results are available for this feature:
BLAST of EY659723 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 67
Match NameE-valueIdentityDescription
CB26_ARATH6.718e-10068.71Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB2_DUNTE2.685e-4044.84Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB21_GOSHI5.794e-3544.29Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB2_CHLMO7.567e-3541.71Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2B_PINSY7.567e-3542.38Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB28_PEA1.291e-3442.86Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB2A_PINSY1.686e-3442.38Chlorophyll a-b binding protein type 2 member 1A, ... [more]
CB24_PETSP2.202e-3442.86Chlorophyll a-b binding protein 25, chloroplastic ... [more]
CB23_ORYSJ2.202e-3443.66Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_ORYSI2.202e-3443.66Chlorophyll a-b binding protein, chloroplastic OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-014-D05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659723 ID=EY659723|Name=EY659723|organism=Citrus sinensis|type=EST|length=912bp
CCACGCGTCCGCTAACACAATTACGCAGCAGCAGCAACACTCTGAAGATG
GCTTCATTGGCAGCATCGTCCACTCCTGCTGCCTCCATTGGAGTTAAGGA
GATGCTTGGCAACCCTCTCAATGTCAGCAGTGCTGTTAGGACTTCAGCTC
CAGGTGCATCAAACCCTTCTACTTTCAAGCCCGTTGCTCTCTTCTCCAAG
AAGAAAGCCGCCCCTCCTGCCAAGTCTAAGCCCGTCGCCGTCTCCCCCGT
TAACGAAGAGCTCGCCAAGTGGTATGGTCCTGACCGAAGAATTTTCTTGC
CCGAGGGTCTCTTGGACAGATCTGAGATCCCTGAGTACTTGACCGGAGAA
GTTCCCGGAGACTATGGTTACGATCCTTTTGGTCTCAGCAAGAAACCAGA
CGACTTCAGCAAATATCAGGCATATGAATTGATTCATGCCAGATGGGCCA
TGCTTGGTGCTGCTGGTTTCATCATTCCTGAAGCCTTTAACAAGTTTGGT
GCTAACTGTGGTCCTGAAGCTGTCTGGTTCAAGACTGGAGCTCTACTTCT
TGATGGAAACACATTGAACTACTTCGGAAAGAACATCCCAATCAACCTTG
TTTTTGCTGTCATTGCTGAGATTGTTCTTGTANGTGGTGCTGAATATTAT
AGAATCACCAACGGTTTGGATTTTGGAGACAAGCTTCACCCAGGTGGTCC
ATTTGACCCACTGGGATTAGCAAANGGATCCTGACAATTTGCATTGCTAA
AGTNGAAGGAGATCAGAATGGGAGACTTGCCATGGTTCGCATGCCTGGGT
TCTTTCTCCAGGCTATGTCACAGTGAAGGTCAGGTGAGAACTTGCTAACA
TCTCAGTGATCCTTTTGCAACAACTGCTTAACGGATCTCCGGAACTAAAA
AAGCTCCACCTG
back to top