EY659707

Overview
NameEY659707
Unique NameEY659707
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length940
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8073 contig Csv1_Contig8073:1532..2471. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659707 vs. ExPASy Swiss-Prot
Match: UPL1_ARATH (E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3)

HSP 1 Score: 488.804 bits (1257), Expect = 1.887e-137
Identity = 240/307 (78.18%), Postives = 267/307 (86.97%), Query Frame = 1
Query:   19 SSKTRVRCKNSXILEDSYNQLRMRSTQDLNPRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNESTFQPNPNSVYQTEHLSYFKFVGRVVGKALFDGQLLDVHFTRSFYKHILGVKVTYHDIEAIDPDYFKNLKWMLENDISDVLDLTFSIDADEEKLILYERAQVTDYELIPGGRNIKVTEENKHQYVDLVAEHRLTTAIRPQINAFLEGFTELIPGELISIFNDQELELLISALPDIDLDDMRANTEYSGYSAASPVIQCLWEVVQRFSKEEKARLLHLVTGPSKCPWR-FPALQ 936
            S   R+  + + +LEDSYNQLRMRS QDL  RL V FQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGN++TFQPNPNSVYQTEHLSYFKFVGR+V KALFDGQLLDV+FTRSFYKHILGVKVTYHDIEA+DPDY+KNLKW+LEND+SD+LDLTFS+DADEEK ILYE+ +VTDYEL PGGRNI+VTEE KH+YVDLVA H LT AIRPQINAFLEGF ELIP EL+SIFND+ELELLIS LP+ID DD++ANTEY+ Y+A SPVI   WEVV+ FSKE+ AR L  VTG SK P   F ALQ
Sbjct: 3316 SGPLRISVRRAYVLEDSYNQLRMRSPQDLKGRLNVQFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNDATFQPNPNSVYQTEHLSYFKFVGRMVAKALFDGQLLDVYFTRSFYKHILGVKVTYHDIEAVDPDYYKNLKWLLENDVSDILDLTFSMDADEEKHILYEKTEVTDYELKPGGRNIRVTEETKHEYVDLVAGHILTNAIRPQINAFLEGFNELIPRELVSIFNDKELELLISGLPEIDFDDLKANTEYTSYTAGSPVIHWFWEVVKAFSKEDMARFLQFVTGTSKVPLEGFKALQ 3622          
BLAST of EY659707 vs. ExPASy Swiss-Prot
Match: UPL2_ARATH (E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana GN=UPL2 PE=1 SV=2)

HSP 1 Score: 487.263 bits (1253), Expect = 5.491e-137
Identity = 238/307 (77.52%), Postives = 268/307 (87.30%), Query Frame = 1
Query:   19 SSKTRVRCKNSXILEDSYNQLRMRSTQDLNPRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNESTFQPNPNSVYQTEHLSYFKFVGRVVGKALFDGQLLDVHFTRSFYKHILGVKVTYHDIEAIDPDYFKNLKWMLENDISDVLDLTFSIDADEEKLILYERAQVTDYELIPGGRNIKVTEENKHQYVDLVAEHRLTTAIRPQINAFLEGFTELIPGELISIFNDQELELLISALPDIDLDDMRANTEYSGYSAASPVIQCLWEVVQRFSKEEKARLLHLVTGPSKCPWR-FPALQ 936
            S   R+  + + +LEDSYNQLRMRS QDL  RL V FQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGN++TFQPNPNSVYQTEHLSYFKFVGR+V KALFDGQLLDV+FTRSFYKHILGVKVTYHDIEA+DPDY+KNLKW+LEND+SD+LDLTFS+DADEEK ILYE+ +VTDYEL PGGRNI+VTEE KH+YVDLVA+H LT+AIRPQINAFLEG  ELIP EL+SIFND+ELELLIS LP+ID DD++ANTEY+ Y+  SPVI+  WEVV+ FSKE+ AR L  VTG SK P   F ALQ
Sbjct: 3293 SGPLRISVRRAYVLEDSYNQLRMRSPQDLKGRLNVQFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNDATFQPNPNSVYQTEHLSYFKFVGRMVAKALFDGQLLDVYFTRSFYKHILGVKVTYHDIEAVDPDYYKNLKWLLENDVSDILDLTFSMDADEEKHILYEKTEVTDYELKPGGRNIRVTEETKHEYVDLVADHILTSAIRPQINAFLEGLNELIPRELVSIFNDKELELLISGLPEIDFDDLKANTEYTSYTVGSPVIRWFWEVVKAFSKEDMARFLQFVTGTSKVPLEGFKALQ 3599          
BLAST of EY659707 vs. ExPASy Swiss-Prot
Match: TOM1_NEUCR (E3 ubiquitin-protein ligase TOM1-like OS=Neurospora crassa GN=B11B22.010 PE=3 SV=3)

HSP 1 Score: 313.923 bits (803), Expect = 8.321e-85
Identity = 154/297 (51.85%), Postives = 212/297 (71.38%), Query Frame = 1
Query:   31 RVRCKNSXILEDSYNQLRMRSTQDLN-PRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNE-STFQPNPNSVYQTEHLSYFKFVGRVVGKALFDGQLLDVHFTRSFYKHILGVKVTYHDIEAIDPDYFKNLKWMLENDISDVLDLTFSIDADEEKLILYERAQVTDYELIPGGRNIKVTEENKHQYVDLVAEHRLTTAIRPQINAFLEGFTELIPGELISIFNDQELELLISALPDIDLDDMRANTEYSGYSAASPVIQCLWEVVQRFSKEEKARLLHLVTGPSKCP 915
            +++ +   +  DS+  L  +   +L   +L + FQGEEG+DAGG+TREW+Q+LSR +FD   +LF  V ++ +TF PN  S    EHL +FKF+GR++GKAL++G+LL+ +F+R+ YK ILG  V+  D+E+ DPDY+K+L WMLENDI+D++  TFS++ D     ++   +V D  LI  GRNI VTEENKH+YV L+ EH+L T+++ Q+ AFL GF E+IP ELI+IFN+QELELLIS LPDID+DD +ANTEY  YSA +P IQ  W  V+ F KEE A+LL  VTG SK P
Sbjct: 3670 QLQVRREHVFHDSFRSLYYKKADELKFGKLNIRFQGEEGVDAGGVTREWFQVLSRQMFDPNYVLFVPVSSDRTTFHPNKLSPINDEHLPFFKFIGRIIGKALYEGRLLECYFSRAVYKRILGKPVSVKDMESFDPDYYKSLVWMLENDITDIITETFSVEDD-----VFGEVKVVD--LIENGRNIPVTEENKHEYVRLIVEHKLITSVKDQMKAFLTGFHEIIPEELIAIFNEQELELLISGLPDIDIDDWKANTEYHNYSAGAPQIQWFWRAVRSFDKEELAKLLQFVTGTSKVP 3959          
BLAST of EY659707 vs. ExPASy Swiss-Prot
Match: PTR1_SCHPO (E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe GN=ptr1 PE=1 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 2.195e-77
Identity = 138/296 (46.62%), Postives = 204/296 (68.92%), Query Frame = 1
Query:   34 VRCKNSXILEDSYNQLRMRSTQDLN-PRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTV-GNESTFQPNPNSVYQTEHLSYFKFVGRVVGKALFDGQLLDVHFTRSFYKHILGVKVTYHDIEAIDPDYFKNLKWMLENDISDVLDLTFSIDADEEKLILYERAQVTDYELIPGGRNIKVTEENKHQYVDLVAEHRLTTAIRPQINAFLEGFTELIPGELISIFNDQELELLISALPDIDLDDMRANTEYSGYSAASPVIQCLWEVVQRFSKEEKARLLHLVTGPSKCP 915
            +  +   +  DSY  L  +   ++   +L +HF+ EEG+DAGG+TREW Q+L+R +F+    LF  V G+ +TF PN +S    +HLS+FKF GR++GKAL+DG+LLD HF+R+ YKH+L   V+  DIE++DPDY+K+L WML NDI+D++   F+++ D    +  E+  V   +LIP GRNI VTE NK  YV+ + +++L  +++ Q+ + L+GF+++IP  LI IFN+QELELLIS LP+ID+DD + NTEY GY+ +SP +Q  W  V+ F +EE+A+LL   TG SK P
Sbjct: 2872 ITVRRDHVFLDSYRALHFKDADEVKFSKLNIHFRDEEGVDAGGVTREWLQVLARQMFNPDYALFLPVTGDATTFHPNRDSSVNPDHLSFFKFTGRIIGKALYDGRLLDCHFSRAVYKHMLHRSVSVKDIESLDPDYYKSLVWMLNNDITDIITEEFAVEKD----VFGEKTVV---DLIPNGRNIPVTELNKQNYVNRMVDYKLRESVKDQLKSLLDGFSDIIPSHLIQIFNEQELELLISGLPEIDIDDWKNNTEYHGYNVSSPQVQWFWRAVRSFDEEERAKLLQFATGTSKVP 3160          
BLAST of EY659707 vs. ExPASy Swiss-Prot
Match: HUWE1_MOUSE (E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus GN=Huwe1 PE=1 SV=4)

HSP 1 Score: 278.1 bits (710), Expect = 5.060e-74
Identity = 150/304 (49.34%), Postives = 204/304 (67.11%), Query Frame = 1
Query:   34 VRCKNSXILEDSYNQLRMRSTQDLNPRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLF-TTVGNESTFQPNPNSVYQTEHLSYFKFVGRVVGKALFDGQLLDVHFTRSFYKHILGVKVTYHDIEAIDPDYFKNLKWMLENDISDV-LDLTFSIDADEEKLILYERAQVTDYELIPGGRNIKVTEENKHQYVDLVAEHRLTTAIRPQINAFLEGFTELIPGELISIFNDQELELLISALPDIDLDDMRANTEYSGYSAASPVIQCLWEVVQRFSKEEKARLLHLVTGPSKCPWR-FPALQ 936
            V  +   + EDSY +L  +S +++  RL + F+GEEG DAGGL REWY ++SR +F+    LF T+ G+  T+  NP+S     HLSYFKFVGR+V KA++D +LL+ +FTRSFYKHILG  V Y D+E+ D  +++ L ++LEND+S +  DLTFS +  E     +   +V D  L P G NI VTEENK +YV LV + R+T AIR Q+ AFLEGF E+IP  LISIF +QELELLIS LP ID+DD+++NTEY  Y + S  IQ  W  ++ F + ++A+ L  VTG SK P + F AL+
Sbjct: 4022 VHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQE-----FGVCEVRD--LKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALE 4318          
BLAST of EY659707 vs. ExPASy Swiss-Prot
Match: HUWE1_HUMAN (E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3)

HSP 1 Score: 278.1 bits (710), Expect = 5.060e-74
Identity = 150/304 (49.34%), Postives = 204/304 (67.11%), Query Frame = 1
Query:   34 VRCKNSXILEDSYNQLRMRSTQDLNPRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLF-TTVGNESTFQPNPNSVYQTEHLSYFKFVGRVVGKALFDGQLLDVHFTRSFYKHILGVKVTYHDIEAIDPDYFKNLKWMLENDISDV-LDLTFSIDADEEKLILYERAQVTDYELIPGGRNIKVTEENKHQYVDLVAEHRLTTAIRPQINAFLEGFTELIPGELISIFNDQELELLISALPDIDLDDMRANTEYSGYSAASPVIQCLWEVVQRFSKEEKARLLHLVTGPSKCPWR-FPALQ 936
            V  +   + EDSY +L  +S +++  RL + F+GEEG DAGGL REWY ++SR +F+    LF T+ G+  T+  NP+S     HLSYFKFVGR+V KA++D +LL+ +FTRSFYKHILG  V Y D+E+ D  +++ L ++LEND+S +  DLTFS +  E     +   +V D  L P G NI VTEENK +YV LV + R+T AIR Q+ AFLEGF E+IP  LISIF +QELELLIS LP ID+DD+++NTEY  Y + S  IQ  W  ++ F + ++A+ L  VTG SK P + F AL+
Sbjct: 4019 VHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQE-----FGVCEVRD--LKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALE 4315          
BLAST of EY659707 vs. ExPASy Swiss-Prot
Match: TOM1_ASHGO (Probable E3 ubiquitin-protein ligase TOM1 OS=Ashbya gossypii GN=TOM1 PE=3 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.923e-73
Identity = 138/299 (46.15%), Postives = 199/299 (66.56%), Query Frame = 1
Query:   25 KTRVRCKNSXILEDSYNQLRMRSTQDLN-PRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNE-STFQPNPNSVYQTEHLSYFKFVGRVVGKALFDGQLLDVHFTRSFYKHILGVKVTYHDIEAIDPDYFKNLKWMLENDISDVLDLTFSIDADEEKLILYERAQVTDYELIPGGRNIKVTEENKHQYVDLVAEHRLTTAIRPQINAFLEGFTELIPGELISIFNDQELELLISALPDIDLDDMRANTEYSGYSAASPVIQCLWEVVQRFSKEEKARLLHLVTGPSKCP 915
            K  +  +   +  DSY  L  +S +D+   +L + F+GE G+DAGG+TREWYQ+LSR +F+    LF  V ++ +TF+PN  S    EHLS+FKF+G ++GKA+ D   LD HF+R  YK+ILG  V   D+E++D DY+K+L W+LENDI+D+++ TFS++ D+     Y   +V   ELI  G ++ VTE+NKH YV  + E++L T+++ Q+  FL+GF  +IP +LISIF++QELELL+S LPDID+DD + NT Y  Y+     I   W  V+ F KEE+A+LL  VTG SK P
Sbjct: 2900 KLSISVRREHVFLDSYRSLFFKSNEDIKISKLEISFKGEAGVDAGGITREWYQVLSRQMFNPDYALFIPVASDKTTFRPNRTSGINPEHLSFFKFIGMIIGKAISDQCFLDCHFSREVYKNILGKPVALKDMESLDLDYYKSLIWILENDITDIIEETFSVETDD-----YGEHKVI--ELIENGAHVAVTEQNKHDYVKKIVEYKLQTSVKDQMENFLQGFYAIIPKDLISIFDEQELELLVSGLPDIDVDDWKNNTIYVNYTPTCKQINYFWRAVRSFDKEERAKLLQFVTGTSKVP 3191          
BLAST of EY659707 vs. ExPASy Swiss-Prot
Match: TOM1_YEAST (E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae GN=TOM1 PE=1 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 1.055e-71
Identity = 138/299 (46.15%), Postives = 199/299 (66.56%), Query Frame = 1
Query:   25 KTRVRCKNSXILEDSYNQLRMRSTQDL-NPRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTV-GNESTFQPNPNSVYQTEHLSYFKFVGRVVGKALFDGQLLDVHFTRSFYKHILGVKVTYHDIEAIDPDYFKNLKWMLENDISDVLDLTFSIDADEEKLILYERAQVTDYELIPGGRNIKVTEENKHQYVDLVAEHRLTTAIRPQINAFLEGFTELIPGELISIFNDQELELLISALPDIDLDDMRANTEYSGYSAASPVIQCLWEVVQRFSKEEKARLLHLVTGPSKCP 915
            K  +  +   +  DSY  L  ++  ++ N +L + F+GE G+DAGG+TREWYQ+LSR +F+    LF  V  +++TF PN  S    EHLS+FKF+G ++GKA+ D   LD HF+R  YK+ILG  V+  D+E++DPDY+K+L W+LENDI+D+++ TFS++ D+     Y   +V +  LI GG++I VTE NK  YV  V E++L T+++ Q++ FL GF  LI  +LI+IF++QELELLIS LPDID+DD + NT Y  Y+A    +   W  V+ F  EE+A+LL  VTG SK P
Sbjct: 2910 KLPITVRREQVFLDSYRALFFKTNDEIKNSKLEITFKGESGVDAGGVTREWYQVLSRQMFNPDYALFLPVPSDKTTFHPNRTSGINPEHLSFFKFIGMIIGKAIRDQCFLDCHFSREVYKNILGRPVSLKDMESLDPDYYKSLVWILENDITDIIEETFSVETDD-----YGEHKVIN--LIEGGKDIIVTEANKQDYVKKVVEYKLQTSVKEQMDNFLVGFYALISKDLITIFDEQELELLISGLPDIDVDDWKNNTTYVNYTATCKEVSYFWRAVRSFDAEERAKLLQFVTGTSKVP 3201          
BLAST of EY659707 vs. ExPASy Swiss-Prot
Match: HACE1_XENTR (E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.684e-69
Identity = 135/275 (49.09%), Postives = 185/275 (67.27%), Query Frame = 1
Query:   97 QDLNPRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNESTFQPNPNSVYQTEHLSYFKFVGRVVGKALFDGQLLDVHFTRSFYKHILGVKVTYHDIEAIDPDYFKNLKWMLENDISDV-LDLTFSIDADEEKLILYERAQVTDYELIPGGRNIKVTEENKHQYVDLVAEHRLTTAIRPQINAFLEGFTELIPGELISIFNDQELELLISALPDIDLDDMRANTEY-SGYSAASPVIQCLWEVVQRFSKEEKARLLHLVTGPSKCP 915
            + L   + V F GEEG+  G + REW+ +LS  I +    LFT   + +TFQPN NS    +HL+YF+F G ++G AL+  QL++++FTRSFYKHILG+ V Y D+ +IDP+Y KNL+W+L+NDISD+ L+LTFS++ D           + +  L PGG +I VT+ENK +YV LV E R+T AI+PQIN FL+GF   IP  LI +F++ ELELL+S +P+ID++D   NTEY SGY     VIQ  WEVVQ  ++EE+  LL  VTG S+ P
Sbjct:  579 EKLKQGIAVRFHGEEGMGQG-VVREWFDILSSEIINPDYALFTQSADGTTFQPNSNSSVNPDHLNYFRFAGEILGLALYHRQLVNIYFTRSFYKHILGIPVNYQDVASIDPEYAKNLQWILDNDISDLGLELTFSVETD-------VFGAMEEVPLKPGGASILVTQENKAEYVQLVTELRMTRAIQPQINGFLQGFHMFIPPSLIQLFDEYELELLLSGMPEIDVNDWMKNTEYTSGYERDDQVIQWFWEVVQELTQEERVLLLQFVTGSSRVP 845          
BLAST of EY659707 vs. ExPASy Swiss-Prot
Match: PUB1_SCHPO (E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe GN=pub1 PE=1 SV=2)

HSP 1 Score: 262.307 bits (669), Expect = 2.873e-69
Identity = 136/296 (45.95%), Postives = 198/296 (66.89%), Query Frame = 1
Query:   34 VRCKNSXILEDSYNQLRMRSTQDLNPRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLF--TTVGNESTFQPNPNSVYQTEHLSYFKFVGRVVGKALFDGQLLDVHFTRSFYKHILGVKVTYHDIEAIDPDYFKNLKWMLENDISDVLDLTFSIDADEEKLILYERAQVTDYELIPGGRNIKVTEENKHQYVDLVAEHRLTTAIRPQINAFLEGFTELIPGELISIFNDQELELLISALPDIDLDDMRANTEYSGYSAASPVIQCLWEVVQRFSKEEKARLLHLVTGPSKCP 915
            ++ + + I EDSY ++  +S  DL  RL + F GE+G+D GGL+RE++ LLS  +F+    LF  ++V N  T Q NP+S    EHL+YFKF+GRV+G A+F  + +D  F  SFYK IL  KVT  D+E++D +Y+++L W+L+NDI+ VLDLTFS+   E+        +V   +L P GRNI+VTEENK +YVDLV   R+   I  Q NAF EGF+ELIP ELI++F+++ELELLI  + +ID++D + +T+Y  YS    +I+  WE++  +S E+K+RLL   TG S+ P
Sbjct:  415 IKVRRNHIFEDSYAEIMRQSATDLKKRLMIKFDGEDGLDYGGLSREYFFLLSHEMFNPFYCLFEYSSVDNY-TLQINPHSGINPEHLNYFKFIGRVIGLAIFHRRFVDAFFVVSFYKMILQKKVTLQDMESMDAEYYRSLVWILDNDITGVLDLTFSV---EDNCF----GEVVTIDLKPNGRNIEVTEENKREYVDLVTVWRIQKRIEEQFNAFHEGFSELIPQELINVFDERELELLIGGISEIDMEDWKKHTDYRSYSENDQIIKWFWELMDEWSNEKKSRLLQFTTGTSRIP 702          
The following BLAST results are available for this feature:
BLAST of EY659707 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
UPL1_ARATH1.887e-13778.18E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis th... [more]
UPL2_ARATH5.491e-13777.52E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis th... [more]
TOM1_NEUCR8.321e-8551.85E3 ubiquitin-protein ligase TOM1-like OS=Neurospor... [more]
PTR1_SCHPO2.195e-7746.62E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharo... [more]
HUWE1_MOUSE5.060e-7449.34E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus ... [more]
HUWE1_HUMAN5.060e-7449.34E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens ... [more]
TOM1_ASHGO1.923e-7346.15Probable E3 ubiquitin-protein ligase TOM1 OS=Ashby... [more]
TOM1_YEAST1.055e-7146.15E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces ... [more]
HACE1_XENTR1.684e-6949.09E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropi... [more]
PUB1_SCHPO2.873e-6945.95E3 ubiquitin-protein ligase pub1 OS=Schizosaccharo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-014-B12-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659707 ID=EY659707|Name=EY659707|organism=Citrus sinensis|type=EST|length=940bp
TGCGGACCGGTCCGGAATTCTTCAAAAACACGCGTCCGCTGTAAGAATAG
CTNAATTCTTGAAGATTCATACAACCAACTGCGCATGCGATCAACGCAAG
ATTTGAACCCAAGGTTGACTGTTCACTTTCAAGGAGAGGAAGGCATTGAT
GCCGGTGGCCTTACAAGGGAGTGGTACCAATTGCTGTCAAGGGTTATTTT
TGACAAGGGAGCCCTACTTTTCACAACAGTGGGCAATGAATCAACATTCC
AGCCCAACCCCAACTCTGTTTACCAAACTGAACATCTTTCATATTTCAAG
TTTGTTGGGCGAGTTGTTGGAAAAGCTCTTTTTGACGGGCAACTGTTGGA
TGTCCATTTTACTCGATCTTTCTACAAGCACATCCTGGGGGTTAAAGTTA
CTTATCATGACATTGAAGCTATTGATCCAGATTACTTCAAAAACCTGAAG
TGGATGCTTGAGAATGACATCAGTGATGTTCTTGACCTCACTTTTAGTAT
TGATGCTGATGAGGAGAAGCTGATTTTGTATGAAAGGGCGCAGGTAACCG
ACTATGAGCTAATTCCTGGTGGACGGAATATTAAAGTTACTGAGGAGAAT
AAGCACCAGTATGTGGATTTAGTTGCGGAGCATCGTTTGACGACTGCTAT
TCGGCCTCAAATAAATGCTTTTCTGGAGGGATTTACCGAACTAATTCCTG
GGGAGTTGATATCTATCTTCAATGACCAGGAATTAGAATTATTGATTAGT
GCGCTTCCCGATATTGATTTGGATGACATGAGGGCAAATACGGAATATTC
TGGATATAGTGCTGCATCTCCTGTTATCCAGTGTCTTTGGGAAGTTGTTC
AACGCTTCAGCAAGGAGGAAAAGGCTCGTCTTCTGCATCTTGTGACTGGC
CCCTCAAAGTGCCCTTGGAGGTTTCCTGCACTTCAAGAAT
back to top