EY659701

Overview
NameEY659701
Unique NameEY659701
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length650
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL2J_ARATH (RING-H2 finger protein ATL2J OS=Arabidopsis thaliana GN=ATL2J PE=2 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 4.024e-17
Identity = 37/72 (51.39%), Postives = 45/72 (62.50%), Query Frame = 3
Query:    3 TRPKANYRTEMASGLKYMKEAHVKDVGTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218
            T P         SG K+ K+ H K++G EC VCL  F D + +RQLS CKH+FH  CI+ WLK H NCPICR
Sbjct:  113 TPPITETTVTSESGGKFHKDTHSKEIGNECSVCLMVFTDSDELRQLSECKHAFHVLCIETWLKDHPNCPICR 184          
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL5A_ARATH (RING-H2 finger protein ATL5A OS=Arabidopsis thaliana GN=ATL5A PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.067e-13
Identity = 33/50 (66.00%), Postives = 35/50 (70.00%), Query Frame = 3
Query:   69 VKDVGTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218
            VK   TEC +CL  FADGE VR L  C HSFH SCID WL SHS+CP CR
Sbjct:   98 VKIAATECAICLGEFADGERVRVLPPCNHSFHMSCIDTWLVSHSSCPNCR 147          
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: EL5_ORYSJ (E3 ubiquitin-protein ligase EL5 OS=Oryza sativa subsp. japonica GN=EL5.1 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.285e-12
Identity = 30/54 (55.56%), Postives = 34/54 (62.96%), Query Frame = 3
Query:   57 KEAHVKDVGTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218
            +E    D G EC VCL+   DGE  R L  C H FHA C+DMWL SHS CP+CR
Sbjct:  123 EEEEEDDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCR 176          
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL2H_ARATH (RING-H2 finger protein ATL2H OS=Arabidopsis thaliana GN=ATL2H PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.285e-12
Identity = 26/56 (46.43%), Postives = 39/56 (69.64%), Query Frame = 3
Query:   51 YMKEAHVKDVGTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218
            +   A  K+ GTEC +CLS F+D + VR ++ C+H FH++CID+W + H  CP+CR
Sbjct:   90 HYSSATKKNHGTECAICLSEFSDEDTVRLITVCRHPFHSNCIDLWFELHKTCPVCR 145          
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL5G_ARATH (Probable RING-H2 finger protein ATL5G OS=Arabidopsis thaliana GN=ATL5G PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.984e-12
Identity = 28/46 (60.87%), Postives = 34/46 (73.91%), Query Frame = 3
Query:   81 GTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218
            G++C VCLS F + E +R L  C H+FH  CID WLKSHSNCP+CR
Sbjct:  139 GSDCSVCLSEFEENESLRLLPKCNHAFHLPCIDTWLKSHSNCPLCR 184          
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL1O_ARATH (RING-H2 finger protein ATL1O OS=Arabidopsis thaliana GN=ATL1O PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 3.898e-12
Identity = 27/45 (60.00%), Postives = 34/45 (75.56%), Query Frame = 3
Query:   84 TECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218
            T+CPVCL+ F + E +R L  C H+FH SCID WL SH+NCP+CR
Sbjct:  175 TDCPVCLNEFEEDESLRLLPKCNHAFHISCIDTWLSSHTNCPLCR 219          
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL4H_ARATH (Putative RING-H2 finger protein ATL4H OS=Arabidopsis thaliana GN=ATL4H PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 6.649e-12
Identity = 27/46 (58.70%), Postives = 33/46 (71.74%), Query Frame = 3
Query:   81 GTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218
            GT+C +CL  F + E +R L  C H+FH  CID WLKSHSNCP+CR
Sbjct:  178 GTDCSICLGEFNEDESLRLLPKCNHTFHVVCIDRWLKSHSNCPLCR 223          
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL2D_ARATH (Putative RING-H2 finger protein ATL2D OS=Arabidopsis thaliana GN=ATL2D PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 8.683e-12
Identity = 30/60 (50.00%), Postives = 39/60 (65.00%), Query Frame = 3
Query:   39 SGLKYMKEAHVKDVGTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218
            S LK +K+      G EC VCLS F D E++R L  C+H+FH  CID WL+ H+ CP+CR
Sbjct:  113 SALKGLKQ------GLECSVCLSKFEDVEILRLLPKCRHAFHIGCIDQWLEQHATCPLCR 166          
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL3A_ARATH (RING-H2 finger protein ATL3A OS=Arabidopsis thaliana GN=ATL3A PE=2 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 1.134e-11
Identity = 27/45 (60.00%), Postives = 33/45 (73.33%), Query Frame = 3
Query:   84 TECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218
            ++C VCLS F + E +R L  C H+FH  CID WLKSHSNCP+CR
Sbjct:  157 SDCSVCLSEFQENESLRLLPKCNHAFHVPCIDTWLKSHSNCPLCR 201          
BLAST of EY659701 vs. ExPASy Swiss-Prot
Match: ATL1P_ARATH (RING-H2 finger protein ATL1P OS=Arabidopsis thaliana GN=ATL1P PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.134e-11
Identity = 29/56 (51.79%), Postives = 35/56 (62.50%), Query Frame = 3
Query:   51 YMKEAHVKDVGTECPVCLSAFADGEVVRQLSACKHSFHASCIDMWLKSHSNCPICR 218
            + ++   KD G EC +CLS    G+  R L  C HSFH  CIDMW +SHS CPICR
Sbjct:  115 FFRQDSCKD-GLECSICLSELVKGDKARLLPKCNHSFHVECIDMWFQSHSTCPICR 169          
The following BLAST results are available for this feature:
BLAST of EY659701 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
ATL2J_ARATH4.024e-1751.39RING-H2 finger protein ATL2J OS=Arabidopsis thalia... [more]
ATL5A_ARATH2.067e-1366.00RING-H2 finger protein ATL5A OS=Arabidopsis thalia... [more]
EL5_ORYSJ2.285e-1255.56E3 ubiquitin-protein ligase EL5 OS=Oryza sativa su... [more]
ATL2H_ARATH2.285e-1246.43RING-H2 finger protein ATL2H OS=Arabidopsis thalia... [more]
ATL5G_ARATH2.984e-1260.87Probable RING-H2 finger protein ATL5G OS=Arabidops... [more]
ATL1O_ARATH3.898e-1260.00RING-H2 finger protein ATL1O OS=Arabidopsis thalia... [more]
ATL4H_ARATH6.649e-1258.70Putative RING-H2 finger protein ATL4H OS=Arabidops... [more]
ATL2D_ARATH8.683e-1250.00Putative RING-H2 finger protein ATL2D OS=Arabidops... [more]
ATL3A_ARATH1.134e-1160.00RING-H2 finger protein ATL3A OS=Arabidopsis thalia... [more]
ATL1P_ARATH1.134e-1151.79RING-H2 finger protein ATL1P OS=Arabidopsis thalia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-014-B06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659701 ID=EY659701|Name=EY659701|organism=Citrus sinensis|type=EST|length=650bp
CCACGCGTCCGAAAGCGAACTACCGCACGGAGATGGCATCGGGGCTCAAG
TATATGAAGGAGGCCCATGTTAAGGACGTGGGCACCGAGTGTCCCGTTTG
CTTGTCTGCGTTCGCTGACGGCGAAGTGGTTCGGCAGCTGAGCGCGTGTA
AACACTCTTTCCATGCTTCTTGCATCGACATGTGGTTGAAATCTCACTCC
AATTGTCCGATCTGTCGCGCTCCCGTTCCCGCCAAGCCCCCTAATAATAA
CAACGCCGCCCCGCCGCGAGAAATCACACGGTTTACATGGCCCATCCTGC
GGCCACTAAGCGTCCAAGTGGCTGCATCGTTAGGTGGAAGATGAGACGCT
GACTTCACTATTCAGTTAGGTATCAACATATCATTATTGGCCGGCTACTT
GGGGTAATGATATACCGTAAATGAATTTGAGTCTTTTGGCTGATGACGAA
AGTGAAAATGAGAAACTTTGATGATGAATTGATGATGAGTGGTGCCTGTC
AATTACTTGACTGCTTGTGCTTTTGCTCACCAGCTTTCATTTGTTCATTA
CTTTGTTTTCTTTGCATTTTGCGCTTCCATTTTGGACTTCTTGTCTGCTT
CTTCAGATATATAAGGGATCCTGACTTGAAAAAAAAAAAAAAAAAAAAAA
back to top