EY659507

Overview
NameEY659507
Unique NameEY659507
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length838
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659507_ssr800 microsatellite EY659507_ssr800:800..814. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659507 vs. ExPASy Swiss-Prot
Match: HDDC2_HUMAN (HD domain-containing protein 2 OS=Homo sapiens GN=HDDC2 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 9.542e-42
Identity = 86/161 (53.42%), Postives = 117/161 (72.67%), Query Frame = 3
Query:   75 VIDFLSLCHRLKTTKRAGWVKRNVNNPESIADHMYRMGLMGLIMADIPGIDRDKCIKMAIVHDIAEAIVGDITPSDGIPKEEKSQREREAITYMCKLLGEGARAKEIDELWMEYEENSTAEAKIVKDFDKAEMILQAVEYENEQGKD--LEEFFQSTAGKF 551
            ++ FL L  +LK   R GWV RNV  PES++DHMYRM +M +++ D   +++D+C+++A+VHD+AE IVGDI P+D IPKEEK +RE EA+  + +LL E  R KE+ ELW EYE  S+AEAK VK  D+ EMILQA EYE+ + K   L++F+ STAGKF
Sbjct:   17 LLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKD-DRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLR-KELYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKF 175          
BLAST of EY659507 vs. ExPASy Swiss-Prot
Match: HDDC2_BOVIN (HD domain-containing protein 2 OS=Bos taurus GN=HDDC2 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 3.626e-41
Identity = 84/161 (52.17%), Postives = 116/161 (72.05%), Query Frame = 3
Query:   75 VIDFLSLCHRLKTTKRAGWVKRNVNNPESIADHMYRMGLMGLIMADIPGIDRDKCIKMAIVHDIAEAIVGDITPSDGIPKEEKSQREREAITYMCKLLGEGARAKEIDELWMEYEENSTAEAKIVKDFDKAEMILQAVEYENEQGKD--LEEFFQSTAGKF 551
            ++ FL L  +LK   R GWV RNV  PES++DHMYRM +M L+  D   +++D+C+++A+VHD+AE IVGDI P+D +P+EEK +RE EA+  + +LL E  + KE+ ELW EYE  S+AEAK VK  D+ EMILQA EYE+ + K   L++F+ STAGKF
Sbjct:   18 LLQFLRLVGQLKRVPRTGWVYRNVQKPESVSDHMYRMAVMALVTKD-EHLNKDRCVRLALVHDMAECIVGDIAPADNVPREEKHRREEEAMKQLTQLLPEDLQ-KELYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLENKPGRLQDFYDSTAGKF 176          
BLAST of EY659507 vs. ExPASy Swiss-Prot
Match: HDDC2_MOUSE (HD domain-containing protein 2 OS=Mus musculus GN=Hddc2 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 4.736e-41
Identity = 86/161 (53.42%), Postives = 115/161 (71.43%), Query Frame = 3
Query:   75 VIDFLSLCHRLKTTKRAGWVKRNVNNPESIADHMYRMGLMGLIMADIPGIDRDKCIKMAIVHDIAEAIVGDITPSDGIPKEEKSQREREAITYMCKLLGEGARAKEIDELWMEYEENSTAEAKIVKDFDKAEMILQAVEYENEQGKD--LEEFFQSTAGKF 551
            ++ FL L  +LK   R GWV RNV  PES++DHMYRM +M ++  D   +++D+CI++A+VHD+AE IVGDI P+D IPKEEK +RE EA+  + +LL E  R KE+ ELW EYE  S+ EAK VK  D+ EMILQA EYE+ + K   L++F+ STAGKF
Sbjct:   12 LLRFLRLVGQLKRVPRTGWVYRNVEKPESVSDHMYRMAVMAMVTRD-DRLNKDRCIRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLR-KELYELWEEYETQSSEEAKFVKQLDQCEMILQASEYEDLENKPGRLQDFYDSTAGKF 170          
BLAST of EY659507 vs. ExPASy Swiss-Prot
Match: HDDC2_DANRE (HD domain-containing protein 2 OS=Danio rerio GN=hddc2 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.378e-40
Identity = 82/161 (50.93%), Postives = 115/161 (71.43%), Query Frame = 3
Query:   75 VIDFLSLCHRLKTTKRAGWVKRNVNNPESIADHMYRMGLMGLIMADIPGIDRDKCIKMAIVHDIAEAIVGDITPSDGIPKEEKSQREREAITYMCKLLGEGARAKEIDELWMEYEENSTAEAKIVKDFDKAEMILQAVEYENEQGKD--LEEFFQSTAGKF 551
            ++ F+ L  +LK   R GWV RN+  PES++DHMYRM +M L + DI  +++++C+K+A+VHD+AE IVGDI P+D + K EK +RE++A+ ++  LL +G R KEI  LW EYE  S+ EAK+VK+ D  EMI+QA EYE  +GK   L+EFF ST GKF
Sbjct:    4 MLQFMKLVGQLKRVPRTGWVYRNIKQPESVSDHMYRMSMMALTIQDI-SVNKERCMKLALVHDLAECIVGDIAPADNVSKAEKHRREKDAMVHITGLLDDGLR-KEIYNLWEEYETQSSPEAKLVKELDNLEMIIQAHEYEELEGKPGRLQEFFVSTEGKF 162          
BLAST of EY659507 vs. ExPASy Swiss-Prot
Match: HDDC2_DICDI (HD domain-containing protein 2 homolog OS=Dictyostelium discoideum GN=hddc2 PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 6.838e-40
Identity = 94/187 (50.27%), Postives = 115/187 (61.50%), Query Frame = 3
Query:   78 IDFLSLCHRLKTTKRAGWVKRNVNNPESIADHMYRMGLMG-------LIMADIPGIDRDKCIKMAIVHDIAEAIVGDITPSDGIPKEEKSQREREAITYMCKLLGEGARAKEIDELWMEYEENSTAEAKIVKDFDKAEMILQAVEYEN-----EQGKDLEEFFQSTAGKFQTELGKAWAAEIVSRRK 602
            ++F  +C +LKT KR GWV   V  PES++DHMYRM +MG       LI  D   ID+ K IKMA+VHD+ E++VGD TP D I KEEK Q E+ AI  +   L  G   KEI +LW EYE+  T EA +VKDFDK EMILQA EYE      E    L+ FF ST GKF   L K+ A ++ S RK
Sbjct:    5 LEFFKICGKLKTLKRTGWVNHGVELPESVSDHMYRMAMMGMCLDKKELIGEDGKEIDKMKIIKMALVHDLGESLVGDFTPHDKITKEEKYQLEKNAIIEITNTL-SGEVGKEIFDLWQEYEDCKTNEALLVKDFDKFEMILQAYEYEKQPHQLENKIKLQSFFDSTRGKFHHPLFKSLALQLESDRK 190          
BLAST of EY659507 vs. ExPASy Swiss-Prot
Match: HDDC2_XENLA (HD domain-containing protein 2 OS=Xenopus laevis GN=hddc2 PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 6.401e-38
Identity = 76/162 (46.91%), Postives = 115/162 (70.99%), Query Frame = 3
Query:   75 VIDFLSLCHRLKTTKRAGWVKRNVNNPESIADHMYRMGLMGLIMADIPGIDRDKCIKMAIVHDIAEAIVGDITPSDGIPKEEKSQREREAITYMCKLLGEGARAKEIDELWMEYEENSTAEAKIVKDFDKAEMILQAVEYENEQGKD--LEEFFQSTAGKFQ 554
            ++ F+ L  +LK   R GW+ R V  PES++DHMYRM +M ++  D   +++D+CI++A+VHD+AE IVGDI P+D I KEEK ++E+ A+ ++ +LL +  +  E+ +LW EYE   TAEAK VK+ D+ EMILQA+EYE  + +   L++F+ STAGKF+
Sbjct:   14 LLQFMKLVGQLKRVPRTGWIYRQVEKPESVSDHMYRMAVMAMLTEDRK-LNKDRCIRLALVHDMAECIVGDIAPADNIAKEEKHRKEKAAMEHLTQLLPDNLKT-EVYDLWEEYEHQFTAEAKFVKELDQCEMILQALEYEELEKRPGRLQDFYNSTAGKFK 173          
BLAST of EY659507 vs. ExPASy Swiss-Prot
Match: YC0H_SCHPO (HD domain-containing protein C4G3.17 OS=Schizosaccharomyces pombe GN=SPCC4G3.17 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 8.359e-38
Identity = 87/183 (47.54%), Postives = 119/183 (65.03%), Query Frame = 3
Query:   75 VIDFLSLCHRLKTTKRAGWVKRNVNNPESIADHMYRMGLMGLIMADIPGIDRDKCIKMAIVHDIAEAIVGDITPSDGIPKEEKSQREREA---ITYMCKLLGEGARAKEIDELWMEYEENSTAEAKIVKDFDKAEMILQAVEYENEQG--KDLEEFFQSTAGK-FQTELGKAWAAEIVSRRKK 605
            ++ FL    RLKTT R GW+   +  PESIADHMYRMG++ ++  D P I++++C+K+A+VHD+AE+IVGDITP + + KEEK + E EA   IT     L    +A+EI EL++EYE  ST EAK VKD DK EMI Q  EYE +    KDL +F  + AGK  Q  L K W  +++  R++
Sbjct:    9 IVPFLDCLSRLKTTPRTGWLYHGIEKPESIADHMYRMGILTMLCND-PSINKERCLKIAVVHDMAESIVGDITPHENVSKEEKHRMESEAMVSITQQLIPLNLSLQAEEIKELFLEYESASTPEAKFVKDIDKFEMIAQMFEYERKFNGEKDLSQF--TWAGKLIQHPLVKGWLNDVLQEREQ 188          
BLAST of EY659507 vs. ExPASy Swiss-Prot
Match: YB92_YEAST (HD domain-containing protein YBR242W OS=Saccharomyces cerevisiae GN=YBR242W PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 3.287e-34
Identity = 76/182 (41.76%), Postives = 120/182 (65.93%), Query Frame = 3
Query:   75 VIDFLSLCHRLKTTKRAGWVKRNVNNPESIADHMYRMGLMGLIMADIPGIDRDKCIKMAIVHDIAEAIVGDITPSDGIPKEEKSQREREAITYMCKLL---GEGARAKEIDELWMEYEENSTAEAKIVKDFDKAEMILQAVEYENEQ--GKDLEEFFQSTAGKFQTELGKAWAAEIVSRRKK 605
            ++ FL++  +LK  +R G++   +   ESI+DHMYR+ ++ +++ D   ++RDKC+++A+VHDIAE++VGDITP D I KEEK +RE E I Y+C  L        AKEI + W+ YE  ++ EA+ VKD DK EM++Q  EYE E    K+ ++FF + A   +T+  K W +++V +R+K
Sbjct:   48 ILAFLNVVQQLKIQRRTGYLDLGIKECESISDHMYRLSIITMLIKD-SRVNRDKCVRIALVHDIAESLVGDITPVDPIGKEEKHRREWETIKYLCNALIKPYNEIAAKEIMDDWLAYENVTSLEARYVKDIDKYEMLVQCFEYEREYKGTKNFDDFFGAVA-SIKTDEVKGWTSDLVVQRQK 227          
BLAST of EY659507 vs. ExPASy Swiss-Prot
Match: YGK1_YEAST (HD domain-containing protein YGL101W OS=Saccharomyces cerevisiae GN=YGL101W PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 9.564e-34
Identity = 75/179 (41.90%), Postives = 115/179 (64.25%), Query Frame = 3
Query:   84 FLSLCHRLKTTKRAGWVKRNVNNPESIADHMYRMGLMGLIMADIPGIDRDKCIKMAIVHDIAEAIVGDITPSDGIPKEEKSQREREAITYMCKLL----GEGARAKEIDELWMEYEENSTAEAKIVKDFDKAEMILQAVEYENEQG--KDLEEFFQSTAGKFQTELGKAWAAEIVSRRK 602
            FL++   LKT +R GWV   ++  ESI+DHMYRMGL  +++ D   +DR+KCI++A+VHD AE++VGDITP+D + KEEK +RE E + Y+C+ +     E A ++EI + W+ YE+ +  E + VKD DK EM++Q  EYE +    KDL++F        +T+  K W   ++  R+
Sbjct:   32 FLNIIQLLKTQRRTGWVDHGIDPCESISDHMYRMGLTTMLITD-KNVDRNKCIRIALVHDFAESLVGDITPNDPMTKEEKHRREFETVKYLCESIIRPCSESA-SREILDDWLAYEKQTCLEGRYVKDIDKYEMLVQCFEYEQKYNGKKDLKQFL-GAINDIKTDEVKKWTQSLLEDRQ 207          
The following BLAST results are available for this feature:
BLAST of EY659507 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
HDDC2_HUMAN9.542e-4253.42HD domain-containing protein 2 OS=Homo sapiens GN=... [more]
HDDC2_BOVIN3.626e-4152.17HD domain-containing protein 2 OS=Bos taurus GN=HD... [more]
HDDC2_MOUSE4.736e-4153.42HD domain-containing protein 2 OS=Mus musculus GN=... [more]
HDDC2_DANRE1.378e-4050.93HD domain-containing protein 2 OS=Danio rerio GN=h... [more]
HDDC2_DICDI6.838e-4050.27HD domain-containing protein 2 homolog OS=Dictyost... [more]
HDDC2_XENLA6.401e-3846.91HD domain-containing protein 2 OS=Xenopus laevis G... [more]
YC0H_SCHPO8.359e-3847.54HD domain-containing protein C4G3.17 OS=Schizosacc... [more]
YB92_YEAST3.287e-3441.76HD domain-containing protein YBR242W OS=Saccharomy... [more]
YGK1_YEAST9.564e-3441.90HD domain-containing protein YGL101W OS=Saccharomy... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-H06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659507 ID=EY659507|Name=EY659507|organism=Citrus sinensis|type=EST|length=838bp
CCGGCGGTGTCAGCATCAATCCTCTCGCTTCCTCCTCTGTTAACGGCGCT
GCTTTCTCTTCTTCCTCTTCGTCCGTGATCGACTTCCTCTCCCTCTGCCA
CCGCCTCAAAACAACGAAGAGAGCAGGATGGGTAAAGAGAAATGTTAACA
ATCCAGAATCGATAGCTGATCATATGTACAGAATGGGATTGATGGGTCTC
ATTATGGCTGACATTCCTGGCATTGACCGAGACAAGTGCATTAAGATGGC
AATTGTTCATGACATTGCGGAAGCTATTGTTGGGGACATTACCCCTTCAG
ATGGAATTCCAAAGGAAGAAAAGAGTCAACGAGAGCGAGAAGCTATAACC
TACATGTGCAAACTATTAGGAGAAGGGGCAAGAGCCAAGGAAATAGATGA
GTTGTGGATGGAGTATGAAGAAAATTCTACTGCAGAGGCCAAAATAGTCA
AGGACTTTGACAAGGCGGAGATGATACTTCAAGCGGTAGAGTACGAAAAT
GAGCAAGGGAAGGATTTGGAGGAGTTTTTCCAGTCAACTGCTGGAAAGTT
TCAGACTGAATTGGGGAAAGCTTGGGCTGCAGAAATTGTTTCAAGGAGAA
AAAAGTGAACTAATTTTCATAAGATGGGCCCTAGTTTGAATTTTCAGATA
GTTTTTGACTTGTTCATGTTACTCGAGGGCCAATCCCTGTCCTGAATTAT
TGCCTCGATCTAATTGTAAATTTCATTATAAGCAAAAATTTGCAGCAGCT
AGTTTGGAAAGCTTTATTTCCTTTACCCCTCCTGTAATGATATGGNNGTT
TATTATTATTATTATTTTTTGGGAAAAAAAAAAAAAAA
back to top