EY659504

Overview
NameEY659504
Unique NameEY659504
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length943
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659504 vs. ExPASy Swiss-Prot
Match: PME61_ARATH (Probable pectinesterase/pectinesterase inhibitor 61 OS=Arabidopsis thaliana GN=PME61 PE=1 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.222e-43
Identity = 111/239 (46.44%), Postives = 141/239 (59.00%), Query Frame = 1
Query:  130 MGYGRLQPSSDPGGSSFREDQPGHATSAPQPXXXXXXXXXXXXXXXFALIIASAVSAVLLVGLKTRAVG---PTIGHKPTQAISRTCSKTLYPNLCVSSLLNFPGSLTASEQDLVHISFNMTLQHFSRALYFTSGISYLQMDPHVRSAFDDCLELLDDSVDALSRSLGSVLLLPGSDINKREDVLTWLIAXLTN--TTPXSRDLKI*TAGE--RSCFRQVDDLXRXGSNCLAIFSAGAK 825
            MGY RL PS   G S+  +  P  ATS P+                 A+++   V   +  G++    G   P +  KPTQAISRTCSK+LYPNLC+ +LL+FPGSLTA E +L+HISFN TLQ FS+ALY +S I+Y QM P VRSA+D CLELLDDSVDAL+R+L SV+++ G +     DV+TWL + +TN  T     D      GE        V DL    SNCLAIF+   K
Sbjct:    1 MGYDRLGPS---GPSNPNQKDP--ATSLPE---LQKKTKTKLILFTLAVLVVGVVCFGIFAGIRAVDSGKTEPKLTRKPTQAISRTCSKSLYPNLCIDTLLDFPGSLTADENELIHISFNATLQKFSKALYTSSTITYTQMPPRVRSAYDSCLELLDDSVDALTRALSSVVVVSGDE--SHSDVMTWLSSAMTNHDTCTDGFDEIEGQGGEVKDQVIGAVKDLSEMVSNCLAIFAGKVK 229          
BLAST of EY659504 vs. ExPASy Swiss-Prot
Match: PME34_ARATH (Probable pectinesterase/pectinesterase inhibitor 34 OS=Arabidopsis thaliana GN=PME34 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 1.108e-36
Identity = 98/248 (39.52%), Postives = 133/248 (53.63%), Query Frame = 1
Query:  130 MGYGRLQPSSDPGG---SSFREDQPGHATSAPQPXXXXXXXXXXXXXXXFALIIASAVSAVLLVGLKTRAV----GPTIGHKPTQAISRTCSKTLYPNLCVSSLLNFPGSLTASE-QDLVHISFNMTLQHFSRALYFTSGISYLQMDPHVRSAFDDCLELLDDSVDALSRSLGSVLLLPGSDINKREDVLTWLIAXLTNTTPXSRDLKI*TAG--ERSCFRQVDDLXRXGSNCLAIFSAGAKTTTFRG 843
            MGY RL PS   G    S+         +++ QP                 L I+  ++A +  G+++R       P +  KP+QAIS+ C  T +P LCV SL++FPGSL AS  +DL+H++ NMTL HFS ALY ++ +S++ M P  RSA+D C+ELLDDSVDALSR+L SV+    S   K +DV TWL A LTN    +        G  +      + +L    SNCLAIFSA      F G
Sbjct:    1 MGYERLGPSGATGSVTTSTTTAPILNQVSTSEQPENNNRRSKKKLVVSSIVLAISLILAAAIFAGVRSRLKLNQSVPGLARKPSQAISKACELTRFPELCVDSLMDFPGSLAASSSKDLIHVTVNMTLHHFSHALYSSASLSFVDMPPRARSAYDSCVELLDDSVDALSRALSSVV----SSSAKPQDVTTWLSAALTNHDTCTEGFDGVDDGGVKDHMTAALQNLSELVSNCLAIFSASHDGDDFAG 244          
The following BLAST results are available for this feature:
BLAST of EY659504 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PME61_ARATH1.222e-4346.44Probable pectinesterase/pectinesterase inhibitor 6... [more]
PME34_ARATH1.108e-3639.52Probable pectinesterase/pectinesterase inhibitor 3... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659504 ID=EY659504|Name=EY659504|organism=Citrus sinensis|type=EST|length=943bp
CGGNATTCCAAGCTCGACCCACGCGTCCGATAATTTGTTTAATTATATTG
TATGCAAACCCTTCACATTCTCCTCGAAGACCCAGCCAAACAAAAAAGAC
TAACTGAGGTCATCGGTACTTGAAATCTGATGGGTTACGGCAGGCTCCAG
CCCTCCTCCGACCCCGGGGGTTCTTCATTCCGCGAGGACCAACCCGGGCA
TGCCACGTCGGCACCCCAGCCTTCTTCCCGCAGCAGGAAGAAGCTCATCC
TCCTCTCCGTCCTCTCATTCGCATTAATCATCGCCTCCGCCGTCTCCGCC
GTCCTCCTCGTGGGCCTCAAGACGCGTGCCGTGGGCCCCACCATCGGCCA
CAAGCCCACCCAGGCCATTTCCCGCACGTGCAGCAAGACCCTCTACCCGA
ACCTCTGCGTCAGCTCGCTCCTCAACTTCCCGGGCTCGCTCACCGCCTCC
GAGCAGGACCTCGTCCACATTTCGTTCAACATGACGCTGCAGCACTTCAG
CAGGGCCCTGTATTTCACCTCCGGTATCTCCTATCTCCAGATGGACCCAC
ACGTGCGCTCCGCATTCGACGACTGCCTCGAGCTCCTGGACGACTCCGTG
GACGCGCTCTCACGCTCCCTTGGCTCCGTGCTGCTGCTACCCGGGAGCGA
TATTAATAAAAGAGAGGACGTGCTGACGTGGCTCATCGCANCGCTGACCA
ACACGACACCTNNGTCGAGGGATTTGAAGATTTGAACGGCCGGTGAAAGA
TCATGTTTTCGACAAGTTGATGACTTGTNCCGATNGGGGAGCAATTGCTT
GGCGATTTTTTCGGCGGGTGCGAAGACGACNACTTTTCGGGGGTGCCGAT
TCAAAAAAAAGGAGGAGCCTGTGACCCTCGAGAAGAGGAGACAATCCCGG
GGAAGAAATGACCACATATATTGCCCCAATATGGGATTAGGGG
back to top