EY659498

Overview
NameEY659498
Unique NameEY659498
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length894
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12463 contig Csv1_Contig12463:297..1190. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659498 vs. ExPASy Swiss-Prot
Match: GDL62_ARATH (GDSL esterase/lipase At4g10955 OS=Arabidopsis thaliana GN=At4g10955 PE=2 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 3.358e-96
Identity = 173/284 (60.92%), Postives = 213/284 (75.00%), Query Frame = 1
Query:   43 FHFKLLHQLENDADFSIFGAIYEFKPPPSHSHSDLSKDGIPRYVIAFRGTLTKPDSFSRDLELDVHLIRNGLHLTSRFEIAIQAVRNMVASVGSSNVWLAGHSLGSAMAMLAGKTVAKTGVFLEAYLFNPPFVSAPIERIKDKRVKHGIRIAGSVITAGLALAAKINHHNTR------LSEDPFLALSAWVPCLFVNPADDICSEYIGYFEHRKKMXEIGAGAIEKLATQHSLGGLFMNAIXKGYVANTSNPLHLIPSANLIVNSTPARDLKETHGIHQWWNPE 876
            FHF+L+ +  +DAD SIFG IYE+K P   S +  S +  PR+VIAFRGT+TK DS SRD+E D+H+IRNGLH T+RFEIAIQAVRN+VASVG S+VWLAGHSLG++MA+L GKT+A+TG F E + FNPPF+SAPIE+IKDKR+KHGIRIAGSVITAGLALA K   H ++         DPF ALS W P L+VNP D +CSEY+GYFEHR KM EIG G +E++ATQHSLGG+ +             P+HLIPS+ L VN + +RD K+ HGIHQWW  +
Sbjct:   65 FHFRLIRKFVDDADNSIFGGIYEYKLPQQLSQTVKSMEFSPRFVIAFRGTVTKVDSISRDIEHDIHVIRNGLHTTTRFEIAIQAVRNIVASVGGSSVWLAGHSLGASMALLTGKTIARTGFFPECFAFNPPFLSAPIEKIKDKRIKHGIRIAGSVITAGLALAKKATQHYSQNDRALPAPPDPFEALSDWFPRLYVNPGDHLCSEYVGYFEHRNKMEEIGIGFVERVATQHSLGGMLLGG---------QEPVHLIPSSVLTVNLSSSRDFKQAHGIHQWWRED 339          
The following BLAST results are available for this feature:
BLAST of EY659498 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
GDL62_ARATH3.358e-9660.92GDSL esterase/lipase At4g10955 OS=Arabidopsis thal... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-G09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659498 ID=EY659498|Name=EY659498|organism=Citrus sinensis|type=EST|length=894bp
GCCTCCGGTNCCGGNAATTCCCGCCTCGACCCACGCGTCCGCTTCCATTT
TAAGTTGCTCCATCAGCTGGAAAACGATGCTGATTTTTCTATATTTGGTG
CCATATATGAATTCAAACCTCCACCCTCTCATTCTCACTCTGATCTCTCA
AAAGATGGAATTCCACGATATGTCATTGCCTTCCGAGGCACCCTCACCAA
ACCAGATTCTTTTTCTCGAGACCTTGAATTGGATGTCCACTTAATCCGAA
ATGGACTCCATCTGACATCTCGTTTTGAGATTGCTATTCAAGCTGTCAGA
AACATGGTTGCTTCTGTAGGTAGTTCAAATGTCTGGTTAGCTGGCCATTC
CCTTGGGTCAGCCATGGCAATGCTCGCTGGGAAGACCGTTGCCAAGACTG
GGGTGTTTCTTGAAGCATATCTGTTTAATCCACCTTTTGTTTCAGCTCCA
ATTGAGAGAATTAAGGATAAGAGAGTGAAGCATGGGATCCGAATAGCGGG
CAGCGTGATCACAGCTGGACTTGCTCTTGCTGCAAAGATTAATCATCACA
ATACGAGGTTGTCTGAAGATCCATTTCTTGCTCTATCTGCATGGGTCCCC
TGTCTATTTGTGAACCCAGCCGACGACATCTGCTCAGAGTATATTGGGTA
TTTTGAACATAGGAAGAAGATGGANGAGATCGGAGCAGGGGCCATTGAGA
AATTGGCGACACAACATTCTCTTGGAGGTCTATTTATGAATGCAATANNG
AAAGGGTATGTGGCGAATACGTCAAACCCTCTGCACCTGATTCCATCGGC
AAATCTGATAGTTAATTCAACTCCTGCACGGGATCTCAAAGAAACCCATG
GGATTCACCAATGGTGGAACCCTGAGTGCAGTTGAATCTCAGCT
back to top