EY659494

Overview
NameEY659494
Unique NameEY659494
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length924
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659494 vs. ExPASy Swiss-Prot
Match: GSH1_SOLLC (Glutamate--cysteine ligase, chloroplastic OS=Solanum lycopersicum GN=GSH1 PE=2 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 1.487e-112
Identity = 186/211 (88.15%), Postives = 198/211 (93.84%), Query Frame = 2
Query:    2 LIMRSHIWADTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVKTGVTPAEKLLDMYHG 634
            L  RSHIW DTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKY+DC G+SFRDF+ GKLP +PGE PTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYDE SLQ+VLDMT DWT  ER MLRNKVPK+GLKTPFRDGLL HVAQDV+KL+K+GLERRGFKETGFLNEVAEVVKTGVTPAEKLL++YHG
Sbjct:  298 LSKRSHIWTDTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYVDCTGLSFRDFMNGKLPPIPGEYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEGSLQSVLDMTFDWTAEERDMLRNKVPKSGLKTPFRDGLLMHVAQDVVKLAKEGLERRGFKETGFLNEVAEVVKTGVTPAEKLLELYHG 508          

HSP 2 Score: 30.0314 bits (66), Expect = 1.487e-112
Identity = 11/16 (68.75%), Postives = 14/16 (87.50%), Query Frame = 3
Query:  633 GMWRESVNPVFEELLY 680
            G W +SV+P+FEELLY
Sbjct:  508 GKWGQSVDPIFEELLY 523          
BLAST of EY659494 vs. ExPASy Swiss-Prot
Match: GSH1_TOBAC (Glutamate--cysteine ligase, chloroplastic OS=Nicotiana tabacum GN=GSH1 PE=2 SV=2)

HSP 1 Score: 395.971 bits (1016), Expect = 1.249e-111
Identity = 185/215 (86.05%), Postives = 200/215 (93.02%), Query Frame = 2
Query:    2 LIMRSHIWADTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVKTGVTPAEKLLDMYHGDVAR 646
            L MRSHIW DTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDF+ GKL  +PG+ PTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYDE SLQ VLDMT+DWT  ER+MLRNKVP +GLKTPFRDGLL+HVAQDV+KL+K+GLERRG+KETGFLNEV EVV+TGVTPAEKLL++YHG   R
Sbjct:  297 LSMRSHIWTDTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFMNGKLSPIPGDYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQTVLDMTSDWTAEEREMLRNKVPTSGLKTPFRDGLLKHVAQDVVKLAKEGLERRGYKETGFLNEVTEVVRTGVTPAEKLLELYHGKWGR 511          

HSP 2 Score: 29.6462 bits (65), Expect = 1.249e-111
Identity = 12/16 (75.00%), Postives = 13/16 (81.25%), Query Frame = 3
Query:  633 GMWRESVNPVFEELLY 680
            G W  SV+PVFEELLY
Sbjct:  507 GKWGRSVDPVFEELLY 522          
BLAST of EY659494 vs. ExPASy Swiss-Prot
Match: GSH1_ARATH (Glutamate--cysteine ligase, chloroplastic OS=Arabidopsis thaliana GN=GSH1 PE=1 SV=2)

HSP 1 Score: 391.734 bits (1005), Expect = 1.786e-110
Identity = 181/212 (85.38%), Postives = 196/212 (92.45%), Query Frame = 2
Query:    2 LIMRSHIWADTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVKTGVTPAEKLLDMYHGD 637
            L MRSHIW DTD +R GMLPFVFDDSFGFEQYVDYALDVPMYF YRK KYIDC GM+FR FLAGKLPCLPGELP+ NDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYD+DSLQ +LD+TADWT  ER+MLRNKVP TGLKTPFRDGLL+HVA+DVLKL+KDGLERRG+KE GFLN V EVV+TGVTPAEKLL+MY+G+
Sbjct:  297 LSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGMTFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEAGFLNAVDEVVRTGVTPAEKLLEMYNGE 508          

HSP 2 Score: 30.0314 bits (66), Expect = 1.786e-110
Identity = 12/16 (75.00%), Postives = 14/16 (87.50%), Query Frame = 3
Query:  633 GMWRESVNPVFEELLY 680
            G W +SV+PVFEELLY
Sbjct:  507 GEWGQSVDPVFEELLY 522          
BLAST of EY659494 vs. ExPASy Swiss-Prot
Match: GSH1_MEDTR (Glutamate--cysteine ligase, chloroplastic OS=Medicago truncatula GN=GSH1 PE=2 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 5.177e-110
Identity = 182/209 (87.08%), Postives = 198/209 (94.74%), Query Frame = 2
Query:    8 MRSHIWADTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVKTGVTPAEKLLDMYHG 634
            MRSHIW DTD +R GMLPFVFDDSFGFEQYVD+ALDVPMYFVYRKKKYIDC GM+FRDFLAGKLPC+PGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVG+LYDE SLQ VLDMTADWT  ER+MLRNKV  TGLKTPFRDGLL+HVA++VL+L+KDGLERRGFKE+GFLN VAEVV+TGVTPAE+LL++YHG
Sbjct:  285 MRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDFALDVPMYFVYRKKKYIDCTGMTFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSLQRVLDMTADWTLEEREMLRNKVTVTGLKTPFRDGLLKHVAEEVLELAKDGLERRGFKESGFLNAVAEVVRTGVTPAERLLELYHG 493          

HSP 2 Score: 26.5646 bits (57), Expect = 5.177e-110
Identity = 10/16 (62.50%), Postives = 13/16 (81.25%), Query Frame = 3
Query:  633 GMWRESVNPVFEELLY 680
            G W +SV+ VF+ELLY
Sbjct:  493 GKWEQSVDHVFDELLY 508          
BLAST of EY659494 vs. ExPASy Swiss-Prot
Match: GSH1_BRAJU (Glutamate--cysteine ligase, chloroplastic OS=Brassica juncea GN=GSH1 PE=1 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 3.332e-109
Identity = 179/212 (84.43%), Postives = 194/212 (91.51%), Query Frame = 2
Query:    2 LIMRSHIWADTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVKTGVTPAEKLLDMYHGD 637
            L MRSHIW DTD +R GMLPFVFDDSFGFEQYVDYALDVPMYF YR  KY+DC GM+FR FLAGKLPCLPGELPT NDWENHLTTIFPEVRLKRY+EMRGADGGPWRRLCALPAFWVGLLYDED LQ+VLD+TADWT  ER+MLRNKVP TGLKTPFRDGLL+HVA+DVLKL+KDGLERRG+KE GFLN V EVV+TGVTPAE LL+MY+G+
Sbjct:  289 LSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGMTFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERRGYKEVGFLNAVTEVVRTGVTPAENLLEMYNGE 500          

HSP 2 Score: 28.8758 bits (63), Expect = 3.332e-109
Identity = 11/16 (68.75%), Postives = 14/16 (87.50%), Query Frame = 3
Query:  633 GMWRESVNPVFEELLY 680
            G W +SV+PVF+ELLY
Sbjct:  499 GEWGQSVDPVFQELLY 514          
BLAST of EY659494 vs. ExPASy Swiss-Prot
Match: GSH1B_ORYSJ (Glutamate--cysteine ligase B, chloroplastic OS=Oryza sativa subsp. japonica GN=GSH1-2 PE=3 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 2.179e-102
Identity = 168/209 (80.38%), Postives = 190/209 (90.91%), Query Frame = 2
Query:    2 LIMRSHIWADTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVKTGVTPAEKLLDMY 628
            L +RSHIW DTDNNR+GMLPFVFDDSFGFE+YVDYALDVPMYFVYR KKYIDC GMSFRDF+ GKLP  PGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDE+SLQ++ DMT+DWT  ER+MLR KVP TGLKTPFRDG +R +A+++L+LSK+GLERRG+KE GFL EV  V+ +GVTPAE+LL++Y
Sbjct:  271 LSLRSHIWTDTDNNRSGMLPFVFDDSFGFERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVGFLREVDAVISSGVTPAERLLNLY 479          

HSP 2 Score: 27.7202 bits (60), Expect = 2.179e-102
Identity = 10/14 (71.43%), Postives = 13/14 (92.86%), Query Frame = 3
Query:  639 WRESVNPVFEELLY 680
            W+ SV+PVF+ELLY
Sbjct:  483 WQRSVDPVFQELLY 496          
BLAST of EY659494 vs. ExPASy Swiss-Prot
Match: GSH1A_ORYSI (Glutamate--cysteine ligase A, chloroplastic OS=Oryza sativa subsp. indica GN=GSH1-1 PE=2 SV=2)

HSP 1 Score: 367.081 bits (941), Expect = 2.179e-102
Identity = 168/209 (80.38%), Postives = 190/209 (90.91%), Query Frame = 2
Query:    2 LIMRSHIWADTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVKTGVTPAEKLLDMY 628
            L +RSHIW DTDNNR+GMLPFVFDDSFGFE+YVDYALDVPMYFVYR KKYIDC GMSFRDF+ GKLP  PGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDE+SLQ++ DMT+DWT  ER+MLR KVP TGLKTPFRDG +R +A+++L+LSK+GLERRG+KE GFL EV  V+ +GVTPAE+LL++Y
Sbjct:  267 LSLRSHIWTDTDNNRSGMLPFVFDDSFGFERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVGFLREVDAVISSGVTPAERLLNLY 475          

HSP 2 Score: 27.7202 bits (60), Expect = 2.179e-102
Identity = 10/14 (71.43%), Postives = 13/14 (92.86%), Query Frame = 3
Query:  639 WRESVNPVFEELLY 680
            W+ SV+PVF+ELLY
Sbjct:  479 WQRSVDPVFQELLY 492          
BLAST of EY659494 vs. ExPASy Swiss-Prot
Match: GSH1A_ORYSJ (Glutamate--cysteine ligase A, chloroplastic OS=Oryza sativa subsp. japonica GN=GSH1-1 PE=2 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 8.237e-102
Identity = 166/209 (79.43%), Postives = 189/209 (90.43%), Query Frame = 2
Query:    2 LIMRSHIWADTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVKTGVTPAEKLLDMY 628
            L +RSHIW DTDNNR+GMLPFVFDDSFGFE+YVDYALD+PMYFVYR KKYIDC GMSFRDF+ GKLP  PGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALP FWVGLLYDE+SLQ++ DMT+DWT  ER+MLR KVP TGLKTPFRDG +R +A+++L+LSK+GLERRG+KE GFL EV  V+ +GVTPAE+LL++Y
Sbjct:  267 LSLRSHIWTDTDNNRSGMLPFVFDDSFGFERYVDYALDIPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPVFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVGFLREVDAVISSGVTPAERLLNLY 475          

HSP 2 Score: 27.7202 bits (60), Expect = 8.237e-102
Identity = 10/14 (71.43%), Postives = 13/14 (92.86%), Query Frame = 3
Query:  639 WRESVNPVFEELLY 680
            W+ SV+PVF+ELLY
Sbjct:  479 WQRSVDPVFQELLY 492          
BLAST of EY659494 vs. ExPASy Swiss-Prot
Match: GSH1B_ORYSI (Glutamate--cysteine ligase B, chloroplastic OS=Oryza sativa subsp. indica GN=GSH1-2 PE=3 SV=2)

HSP 1 Score: 364.77 bits (935), Expect = 1.075e-101
Identity = 167/209 (79.90%), Postives = 189/209 (90.43%), Query Frame = 2
Query:    2 LIMRSHIWADTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFLAGKLPCLPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERRGFKETGFLNEVAEVVKTGVTPAEKLLDMY 628
            L +RSHIW DTDNNR+GMLPFVFDDSFGFE+YVDYALDVPMYFVYR KKYIDC GMSFRDF+ GKLP  PGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDE+SLQ++ DMT+DWT  ER+MLR KVP TGLKTPFRDG +R +A+++L+LSK+GLERRG+KE  FL EV  V+ +GVTPAE+LL++Y
Sbjct:  271 LSLRSHIWTDTDNNRSGMLPFVFDDSFGFERYVDYALDVPMYFVYRNKKYIDCTGMSFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERRGYKEVSFLREVDAVISSGVTPAERLLNLY 479          

HSP 2 Score: 27.7202 bits (60), Expect = 1.075e-101
Identity = 10/14 (71.43%), Postives = 13/14 (92.86%), Query Frame = 3
Query:  639 WRESVNPVFEELLY 680
            W+ SV+PVF+ELLY
Sbjct:  483 WQRSVDPVFQELLY 496          
The following BLAST results are available for this feature:
BLAST of EY659494 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
GSH1_SOLLC1.487e-11288.15Glutamate--cysteine ligase, chloroplastic OS=Solan... [more]
GSH1_TOBAC1.249e-11186.05Glutamate--cysteine ligase, chloroplastic OS=Nicot... [more]
GSH1_ARATH1.786e-11085.38Glutamate--cysteine ligase, chloroplastic OS=Arabi... [more]
GSH1_MEDTR5.177e-11087.08Glutamate--cysteine ligase, chloroplastic OS=Medic... [more]
GSH1_BRAJU3.332e-10984.43Glutamate--cysteine ligase, chloroplastic OS=Brass... [more]
GSH1B_ORYSJ2.179e-10280.38Glutamate--cysteine ligase B, chloroplastic OS=Ory... [more]
GSH1A_ORYSI2.179e-10280.38Glutamate--cysteine ligase A, chloroplastic OS=Ory... [more]
GSH1A_ORYSJ8.237e-10279.43Glutamate--cysteine ligase A, chloroplastic OS=Ory... [more]
GSH1B_ORYSI1.075e-10179.90Glutamate--cysteine ligase B, chloroplastic OS=Ory... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-G05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659494 ID=EY659494|Name=EY659494|organism=Citrus sinensis|type=EST|length=924bp
TCTCATCATGAGAAGCCACATCTGGGCAGACACCGATAACAATCGTGCTG
GCATGCTTCCCTTTGTTTTTGATGACTCCTTTGGGTTTGAGCAATATGTT
GATTACGCCCTTGATGTTCCAATGTATTTTGTTTATCGCAAAAAGAAGTA
TATTGATTGTGCTGGGATGTCATTCAGGGACTTCTTGGCTGGAAAACTTC
CGTGCCTTCCTGGTGAATTGCCAACTCTTAATGATTGGGAAAATCATCTG
ACAACAATATTTCCCGAGGTTAGGTTGAAGAGATACTTGGAGATGAGAGG
CGCTGATGGAGGGCCTTGGAGGAGGTTATGTGCTTTGCCTGCATTTTGGG
TAGGTTTGTTATATGACGAGGACTCTCTCCAGAATGTTCTAGACATGACA
GCAGATTGGACTACAGGTGAAAGACAAATGTTGAGGAATAAGGTCCCAAA
GACTGGTCTAAAGACGCCATTTCGGGATGGTTTGCTAAGGCATGTTGCCC
AAGATGTTTTAAAGTTGTCAAAGGATGGTTTGGAACGGAGAGGCTTCAAA
GAGACAGGGTTCTTGAATGAGGTGGCTGAGGTAGTCAAAACAGGGGTGAC
ACCGGCGGAAAAACTATTGGACATGTATCATGGGGATGTGGCGAGAGTCA
GTAAATCCTGTTTTTGAGGAGCTACTTTATTAGGATGAGTTAAGATTATT
TCGACACGCTTCTGTTTGCAATTGGTGCTTAANGTTTTGGGGAGTAATCC
TTTTGTTCCGTCCCTACCTGTTTTAATTTATGATCATTAGGAATAAAGGN
TGATGTAAATTCTCAGCATGAGGGATCCTATGCAAGCAACTCTGATTGAG
GTAACCGGATCCGAAACTTGGGGCAGCTCGACCAAAAAATGAGTACGCCA
TGTGACTTGGAACCTTAATATGTG
back to top