EY659361

Overview
NameEY659361
Unique NameEY659361
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length919
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6979 contig Csv1_Contig6979:2..920. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659361 vs. ExPASy Swiss-Prot
Match: NEP2_NEPGR (Aspartic proteinase nepenthesin-2 OS=Nepenthes gracilis GN=nep2 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.641e-19
Identity = 56/166 (33.73%), Postives = 78/166 (46.99%), Query Frame = 3
Query:  291 LRQDQSRVKSIHSRLSKNSGSLDEIRQSDDATLPAKDGSVVGAGNYIVTVGIGTPKKDLSLIFDTGSDLTWTQCEPCVKYCYEQKEPKFDPTVXXXXXXXXXXXTICTSLQSATGNSPACASSTCLYGIQYGDSSFSIGFFGKETXTLTPRDVFPNFPLGCGQNNR 788
            +++ + R++SI++ L  +SG    +   D              G Y++ V IGTP    S I DTGSDL WTQCEPC + C+ Q  P F+P               C  L S T     C ++ C Y   YGD S + G+   ET T     V PN   GCG++N+
Sbjct:   65 IKRGERRMRSINAMLQSSSGIETPVYAGD--------------GEYLMNVAIGTPDSSFSAIMDTGSDLIWTQCEPCTQ-CFSQPTPIFNPQDSSSFSTLPCESQYCQDLPSET-----CNNNECQYTYGYGDGSTTQGYMATETFTFETSSV-PNIAFGCGEDNQ 209          
BLAST of EY659361 vs. ExPASy Swiss-Prot
Match: NEP1_NEPGR (Aspartic proteinase nepenthesin-1 OS=Nepenthes gracilis GN=nep1 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.641e-19
Identity = 49/125 (39.20%), Postives = 67/125 (53.60%), Query Frame = 3
Query:  414 GAGNYIVTVGIGTPKKDLSLIFDTGSDLTWTQCEPCVKYCYEQKEPKFDPTVXXXXXXXXXXXTICTSLQSATGNSPACASSTCLYGIQYGDSSFSIGFFGKETXTLTPRDVFPNFPLGCGQNNR 788
            G G Y++ + IGTP +  S I DTGSDL WTQC+PC + C+ Q  P F+P              +C +L     +SP C+++ C Y   YGD S + G  G ET T     + PN   GCG+NN+
Sbjct:   91 GDGEYLMNLSIGTPAQPFSAIMDTGSDLIWTQCQPCTQ-CFNQSTPIFNPQGSSSFSTLPCSSQLCQAL-----SSPTCSNNFCQYTYGYGDGSETQGSMGTETLTFGSVSI-PNITFGCGENNQ 208          
The following BLAST results are available for this feature:
BLAST of EY659361 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
NEP2_NEPGR2.641e-1933.73Aspartic proteinase nepenthesin-2 OS=Nepenthes gra... [more]
NEP1_NEPGR2.641e-1939.20Aspartic proteinase nepenthesin-1 OS=Nepenthes gra... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-C11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659361 ID=EY659361|Name=EY659361|organism=Citrus sinensis|type=EST|length=919bp
CCACGCGTCCGGGTTCACTTAAATTTATTCTCTCTGCTTATCTTCTCTCA
CTAAGCCTTTGCTATGCTTTCGAAGAAAGAGTCGCCGCAGAAAGCCAACA
TGAGCTTCAACATATGCATACAATTCAACTCAGCTCTCTTCTTCCATCAT
CTGTTTGCAATCCTTCCACAAAAGGCAATGCGAAGAAATCATCGTTGAAA
GTCGTGCACAAGCACGGTCCATGTTTCAAGCCTTATAGTAATGGAGAAAA
AGCAGCGTCTCCATCACCATCAGTATCACATGCAGAGATCCTTCGGCAAG
ACCAGTCTAGAGTTAAATCAATCCACTCAAGACTCTCTAAGAACTCAGGC
AGCCTTGATGAGATCAGGCAGTCGGACGACGCCACGCTCCCCGCCAAGGA
CGGTAGCGTCGTGGGTGCCGGCAATTACATTGTCACGGTGGGTATTGGTA
CCCCCAAGAAAGATTTATCCCTCATTTTTGACACCGGAAGTGACCTCACA
TGGACTCAATGTGAGCCTTGCGTCAAATACTGCTATGAACAAAAGGAGCC
AAAATTTGACCCCACCGTGTCCCAATCATATAGCAACGTGTCTTGCTCGT
CGACAATCTGCACTTCGCTCCAATCAGCCACAGGTAACTCACCAGCTTGT
GCATCATCCACATGCCTCTATGGGATTCAATACGGAGACTCATCATTCTC
CATTGGCTTCTTCGGGAAAGAAACCCNTACCCTGACACCCAGGGACGTTT
TCCCTAACTTCCCTCTCGGCTGCGGCCAAAACAACCGCGGGCTCTTCGGC
GGCGCTGCCGGGTTAATGGGTCTCGGNCGTGACCAATCTCACTAGTTTCC
CAAACAGCACAAATACAAGAAACTCTCTCATATTGCCTCCTTTCGTCGCA
GCTCAACGGNTCACTCACT
back to top