EY659358

Overview
NameEY659358
Unique NameEY659358
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length846
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3251 contig Csv1_Contig3251:298..1144. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659358 vs. ExPASy Swiss-Prot
Match: MCCB_ARATH (Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Arabidopsis thaliana GN=MCCB PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 7.084e-61
Identity = 115/139 (82.73%), Postives = 126/139 (90.65%), Query Frame = 3
Query:    6 NEFVTPFGFVSVQTLVTGFAKIFGQPVGIIGNNGILFHESALKGAHFIELCTQRKIPLVFLQNITGFMVGSRSEANGIAKAGAKMVMAVSCAKVPKVTIIVGGSFGAGNYAMCGRAYSPNFMFLWPNARISVMGGAQVA 422
            +EF   +G     TLVTGFA+I+GQ VGIIGNNGILF+ESALKGAHFIELC+QRKIPLVFLQNITGFMVGSR+EANGIAKAGAKMVMAVSCAKVPK+TII G SFGAGNYAMCGRAYSP+FMF+WPNARI +MGGAQ A
Sbjct:  369 DEFKKQYG----TTLVTGFARIYGQTVGIIGNNGILFNESALKGAHFIELCSQRKIPLVFLQNITGFMVGSRAEANGIAKAGAKMVMAVSCAKVPKITIITGASFGAGNYAMCGRAYSPDFMFIWPNARIGIMGGAQAA 503          
BLAST of EY659358 vs. ExPASy Swiss-Prot
Match: MCCB_RAT (Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus GN=Mccc2 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.529e-55
Identity = 104/144 (72.22%), Postives = 119/144 (82.64%), Query Frame = 3
Query:    6 NEFVTPFGFVSVQTLVTGFAKIFGQPVGIIGNNGILFHESALKGAHFIELCTQRKIPLVFLQNITGFMVGSRSEANGIAKAGAKMVMAVSCAKVPKVTIIVGGSFGAGNYAMCGRAYSPNFMFLWPNARISVMGGAQVASPIKT 437
            NEF   +G     TLVTGFA+IFG PVGIIGNNG+LF ESA KGAHF++LC QR IPL+FLQNITGFMVG   EA GIAK GAKMV AVSCAKVPK+T+I+GGS+GAGNY MCGRAYSP F+++WPNARISVMGG Q A+ + T
Sbjct:  345 NEFKALYG----DTLVTGFARIFGYPVGIIGNNGVLFSESAKKGAHFVQLCCQRNIPLLFLQNITGFMVGKDYEAEGIAKDGAKMVAAVSCAKVPKITVIIGGSYGAGNYGMCGRAYSPRFLYMWPNARISVMGGEQAATVLAT 484          
BLAST of EY659358 vs. ExPASy Swiss-Prot
Match: MCCB_MOUSE (Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus GN=Mccc2 PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 4.447e-55
Identity = 103/144 (71.53%), Postives = 119/144 (82.64%), Query Frame = 3
Query:    6 NEFVTPFGFVSVQTLVTGFAKIFGQPVGIIGNNGILFHESALKGAHFIELCTQRKIPLVFLQNITGFMVGSRSEANGIAKAGAKMVMAVSCAKVPKVTIIVGGSFGAGNYAMCGRAYSPNFMFLWPNARISVMGGAQVASPIKT 437
            NEF   +G     TLVTGFA+IFG PVGIIGNNG+LF ESA KGAHF++LC QR IPL+FLQNITGFMVG   EA GIAK GAKMV AV+CAKVPK+T+I+GGS+GAGNY MCGRAYSP F+++WPNARISVMGG Q A+ + T
Sbjct:  345 NEFKALYG----DTLVTGFARIFGYPVGIIGNNGVLFSESAKKGAHFVQLCCQRNIPLLFLQNITGFMVGRDYEAEGIAKDGAKMVAAVACAKVPKITVIIGGSYGAGNYGMCGRAYSPRFLYMWPNARISVMGGEQAATVLAT 484          
BLAST of EY659358 vs. ExPASy Swiss-Prot
Match: MCCB_DROME (Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Drosophila melanogaster GN=L(2)04524 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 4.917e-54
Identity = 99/136 (72.79%), Postives = 116/136 (85.29%), Query Frame = 3
Query:   18 TPFGFVSVQTLVTGFAKIFGQPVGIIGNNGILFHESALKGAHFIELCTQRKIPLVFLQNITGFMVGSRSEANGIAKAGAKMVMAVSCAKVPKVTIIVGGSFGAGNYAMCGRAYSPNFMFLWPNARISVMGGAQVAS 425
            T F  +  +TLV GFAK++G  VGI+GNNG+LF ESALKGAHFI+LC QRKIPLVFLQNITGFMVG  +EANGIAK GAKMV AV+CA VPK T+I+GGS+GAGNY MCGRAYSP F+++WPN+RISVMGG Q A+
Sbjct:  360 TEFKKLYGETLVCGFAKLYGHTVGIVGNNGVLFSESALKGAHFIQLCAQRKIPLVFLQNITGFMVGRDAEANGIAKNGAKMVTAVACANVPKFTVIIGGSYGAGNYGMCGRAYSPRFLYMWPNSRISVMGGTQAAN 495          
BLAST of EY659358 vs. ExPASy Swiss-Prot
Match: MCCB_HUMAN (Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens GN=MCCC2 PE=1 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.868e-53
Identity = 96/131 (73.28%), Postives = 113/131 (86.26%), Query Frame = 3
Query:   45 TLVTGFAKIFGQPVGIIGNNGILFHESALKGAHFIELCTQRKIPLVFLQNITGFMVGSRSEANGIAKAGAKMVMAVSCAKVPKVTIIVGGSFGAGNYAMCGRAYSPNFMFLWPNARISVMGGAQVASPIKT 437
            TLVTGFA+IFG PVGI+GNNG+LF ESA KG HF++LC QR IPL+FLQNITGFMVG   EA GIAK GAKMV AV+CA+VPK+T+I+GGS+GAGNY MCGRAYSP F+++WPNARISVMGG Q A+ + T
Sbjct:  354 TLVTGFARIFGYPVGIVGNNGVLFSESAKKGTHFVQLCCQRNIPLLFLQNITGFMVGREYEAEGIAKDGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAANVLAT 484          
BLAST of EY659358 vs. ExPASy Swiss-Prot
Match: MCCB_CAEEL (Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Caenorhabditis elegans GN=F02A9.4 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 7.100e-53
Identity = 98/144 (68.06%), Postives = 120/144 (83.33%), Query Frame = 3
Query:    6 NEFVTPFGFVSVQTLVTGFAKIFGQPVGIIGNNGILFHESALKGAHFIELCTQRKIPLVFLQNITGFMVGSRSEANGIAKAGAKMVMAVSCAKVPKVTIIVGGSFGAGNYAMCGRAYSPNFMFLWPNARISVMGGAQVASPIKT 437
            +EF   +G    +TLVTGFA I+GQ VGI+ NNG+LF ESA+KG+HFIELC QRKIPL+FLQNITGFMVG  +EA GIAK GAK+V AV+CAKVPK+T++VGGS+GAGNY MCGR YSP ++F+WPN+RISVMGG Q A+ + T
Sbjct:  390 HEFKERYG----ETLVTGFATIYGQRVGILANNGVLFAESAMKGSHFIELCCQRKIPLLFLQNITGFMVGRDAEAGGIAKHGAKLVTAVACAKVPKITVLVGGSYGAGNYGMCGRGYSPRYVFMWPNSRISVMGGEQAANVLST 529          
BLAST of EY659358 vs. ExPASy Swiss-Prot
Match: MCCB_DICDI (Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Dictyostelium discoideum GN=mccb PE=3 SV=2)

HSP 1 Score: 204.527 bits (519), Expect = 6.011e-52
Identity = 96/127 (75.59%), Postives = 110/127 (86.61%), Query Frame = 3
Query:   45 TLVTGFAKIFGQPVGIIGNNGILFHESALKGAHFIELCTQRKIPLVFLQNITGFMVGSRSEANGIAKAGAKMVMAVSCAKVPKVTIIVGGSFGAGNYAMCGRAYSPNFMFLWPNARISVMGGAQVAS 425
            TL+ GFA++ G PVGII NNGILF ESA+KGAHFIELC QR IPLVFLQNITGFMVG   E+ GIAK GAKMVMAV+ AKVPK+T+I+GGSFGAGNY MCGR+YSP F+++WPNA+ISVMGG Q AS
Sbjct:  377 TLICGFARVHGMPVGIIANNGILFSESAVKGAHFIELCNQRGIPLVFLQNITGFMVGKTYESKGIAKDGAKMVMAVATAKVPKITMIIGGSFGAGNYGMCGRSYSPRFLYMWPNAKISVMGGEQAAS 503          
BLAST of EY659358 vs. ExPASy Swiss-Prot
Match: YNGE_BACSU (Uncharacterized carboxylase yngE OS=Bacillus subtilis GN=yngE PE=3 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 2.300e-27
Identity = 64/125 (51.20%), Postives = 86/125 (68.80%), Query Frame = 3
Query:   48 LVTGFAKIFGQPVGIIGNN-----GILFHESALKGAHFIELCTQRKIPLVFLQNITGFMVGSRSEANGIAKAGAKMVMAVSCAKVPKVTIIVGGSFGAGNYAMCGRAYSPNFMFLWPNARISVMG 407
            L+TG A+I GQPVGI+ N      G+LFH+SA K A FI LC    IPL+FL +I GFM+G++ E  GI + GAKM+ A+S A VPK+++IV  ++GAG YAM G A+ P+     P A+I+VMG
Sbjct:  303 LLTGLARIHGQPVGIVANQPKVKGGVLFHDSADKAAKFITLCDAFHIPLLFLADIPGFMIGTKVEQAGIIRHGAKMISAMSEATVPKLSVIVRKAYGAGLYAMAGPAFEPDCCLALPTAQIAVMG 427          
BLAST of EY659358 vs. ExPASy Swiss-Prot
Match: 12S_PROFR (Methylmalonyl-CoA carboxyltransferase 12S subunit OS=Propionibacterium freudenreichii subsp. shermanii PE=1 SV=3)

HSP 1 Score: 97.4413 bits (241), Expect = 1.035e-19
Identity = 52/133 (39.10%), Postives = 78/133 (58.65%), Query Frame = 3
Query:   48 LVTGFAKIFGQPVGIIGN-----NGILFHESALKGAHFIELCTQRKIPLVFLQNITGFMVGSRSEANGIAKAGAKMVMAVSCAKVPKVTIIVGGSFGAGNYAMCGRAYSPNFMFLWPNARISVMGGAQVASPI 431
            LVT FA++ G+ VGI+ N     +G L   ++ K A F+  C    IPLV L ++ GF+ G + E  GI + GAKM+ A S A VPK+T+++  ++G    AMC R    + ++ WP+A I+VMG    A+ I
Sbjct:  317 LVTAFARVNGRSVGIVANQPSVMSGCLDINASDKAAEFVNFCDSFNIPLVQLVDVPGFLPGVQQEYGGIIRHGAKMLYAYSEATVPKITVVLRKAYGGSYLAMCNRDLGADAVYAWPSAEIAVMGAEGAANVI 449          
BLAST of EY659358 vs. ExPASy Swiss-Prot
Match: PCCB_BACSU (Putative propionyl-CoA carboxylase beta chain OS=Bacillus subtilis GN=yqjD PE=3 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 1.765e-19
Identity = 55/151 (36.42%), Postives = 84/151 (55.63%), Query Frame = 3
Query:    3 INEFVTPFGFVSVQ-----TLVTGFAKIFGQPVGIIGNN-----GILFHESALKGAHFIELCTQRKIPLVFLQNITGFMVGSRSEANGIAKAGAKMVMAVSCAKVPKVTIIVGGSFGAGNYAMCGRAYSPNFMFLWPNARISVMGGAQVAS 425
            I E   P  F  +Q      +V GFA++  + +GI+ +      G L  ++A K A FI  C    IPL+ ++++ GF+ G + E NGI + GAK++ A + A VPKVT+I+  ++G    AM  +A   + +F WPNA I+VMG    AS
Sbjct:  280 IRELADPQSFFEIQPFFAKNIVIGFARLGEKAIGIVASQPKHLAGSLTIDAADKAARFIRFCDAFDIPLLTVEDVPGFLPGIQQEHNGIIRHGAKLLFAYAEATVPKVTLIIRKAYGGAYVAMNSKAIGADLVFAWPNAEIAVMGPEGAAS 430          
The following BLAST results are available for this feature:
BLAST of EY659358 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
MCCB_ARATH7.084e-6182.73Methylcrotonoyl-CoA carboxylase beta chain, mitoch... [more]
MCCB_RAT1.529e-5572.22Methylcrotonoyl-CoA carboxylase beta chain, mitoch... [more]
MCCB_MOUSE4.447e-5571.53Methylcrotonoyl-CoA carboxylase beta chain, mitoch... [more]
MCCB_DROME4.917e-5472.79Probable methylcrotonoyl-CoA carboxylase beta chai... [more]
MCCB_HUMAN1.868e-5373.28Methylcrotonoyl-CoA carboxylase beta chain, mitoch... [more]
MCCB_CAEEL7.100e-5368.06Probable methylcrotonoyl-CoA carboxylase beta chai... [more]
MCCB_DICDI6.011e-5275.59Methylcrotonoyl-CoA carboxylase beta chain, mitoch... [more]
YNGE_BACSU2.300e-2751.20Uncharacterized carboxylase yngE OS=Bacillus subti... [more]
12S_PROFR1.035e-1939.10Methylmalonyl-CoA carboxyltransferase 12S subunit ... [more]
PCCB_BACSU1.765e-1936.42Putative propionyl-CoA carboxylase beta chain OS=B... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-C07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659358 ID=EY659358|Name=EY659358|organism=Citrus sinensis|type=EST|length=846bp
ATATCAATGAGTTTGTAACTCCATTTGGATTTGTATCTGTGCAGACACTT
GTGACTGGTTTTGCTAAAATCTTTGGTCAACCAGTGGGAATCATTGGAAA
CAATGGAATATTATTCCATGAATCTGCTCTAAAAGGGGCCCATTTCATTG
AACTTTGCACTCAACGGAAAATTCCATTGGTCTTTCTTCAGAATATTACT
GGATTCATGGTTGGCTCAAGATCTGAAGCAAATGGTATAGCAAAGGCTGG
AGCAAAAATGGTGATGGCAGTTTCTTGTGCAAAGGTACCAAAAGTTACAA
TAATTGTTGGAGGTAGTTTTGGTGCTGGAAATTATGCGATGTGTGGGCGT
GCGTATAGTCCCAATTTCATGTTTCTTTGGCCAAATGCCAGAATATCTGT
AATGGGTGGTGCTCAGGTAGCCTCTCCTATCAAAACTTTCTTGCACACAA
CTAATATGTCATCATGCATTTCCTTTGAAGTGAGGGGCATATAGATTTTA
TGATTCATGAATCTGAGTATTTCGATTAATACGTAGTGCTTCTTGCGAAC
AATCTACAATCCTAAGTCCTAACTACAGAAGGAAGATCACATATTGCTTT
CTCCTCTCAAATAAATATCCAATGATTGTTCTTTTTATTACTTCATGAAA
ATTTTGGTTAATTTCCCTGGTNCTTGGACTTCCTCTCTTTGCATTTTCAC
AATGTTTTCCCCATCCTTGAAACCTAATGAACCCGATCGTTACATAGCAA
TTACTTGACTCCTAATTTNATATTTGTTTAAGNATGAATGTTTACTTCCC
TGGCAAACGTAAGCTGCTGGATGCTGTCTCAGTAGAAAGGACAAAA
back to top