EY659357

Overview
NameEY659357
Unique NameEY659357
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length869
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6052 contig Csv1_Contig6052:357..1226. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL1_ARATH (rRNA 2'-O-methyltransferase fibrillarin 1 OS=Arabidopsis thaliana GN=FIB1 PE=1 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.817e-83
Identity = 162/211 (76.78%), Postives = 174/211 (82.46%), Query Frame = 2
Query:  236 SKVVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKL-EVILLFLSRKLHRFTCSAGAVFQSEVKTCNR-SFQP 862
            SKV+VEPHRH GVFIAKGKEDALVTKNLV GEAVYNEKRISVQNEDGTKVEYR+WNPFRSKLAAA+LGGVDNIWIKPG +VLYLGAASGTTVSHVSD+VGP G VYAVEFSHRSGRD  +MAKKRTNVIPII DARHPA YRMLVGMVD IFSDVA PDQARIL L    F K     ++ +       T +A AVFQSEVK   +  F+P
Sbjct:   67 SKVIVEPHRHAGVFIAKGKEDALVTKNLVPGEAVYNEKRISVQNEDGTKVEYRVWNPFRSKLAAAILGGVDNIWIKPGAKVLYLGAASGTTVSHVSDLVGPEGCVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASFFLKTGGHFVISIKANCIDSTVAAEAVFQSEVKKLQQEQFKP 277          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL2_ARATH (rRNA 2'-O-methyltransferase fibrillarin 2 OS=Arabidopsis thaliana GN=FIB2 PE=1 SV=2)

HSP 1 Score: 305.064 bits (780), Expect = 3.426e-82
Identity = 160/211 (75.83%), Postives = 172/211 (81.52%), Query Frame = 2
Query:  236 SKVVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKL-EVILLFLSRKLHRFTCSAGAVFQSEVKTCNR-SFQP 862
            SKV+VEPHRH GVFIAKGKEDALVTKNLV GEAVYNEKRISVQNEDGTK EYR+WNPFRSKLAAA+LGGVDNIWIKPG +VLYLGAASGTTVSHVSD+VGP G VYAVEFSHRSGRD  +MAKKRTNVIPII DARHPA YRMLVGMVD IFSDVA PDQARIL L    F K     ++ +       T  A AVFQ+EVK   +  F+P
Sbjct:   78 SKVIVEPHRHAGVFIAKGKEDALVTKNLVPGEAVYNEKRISVQNEDGTKTEYRVWNPFRSKLAAAILGGVDNIWIKPGAKVLYLGAASGTTVSHVSDLVGPEGCVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKSGGHFVISIKANCIDSTVPAEAVFQTEVKKLQQEQFKP 288          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL_SCHPO (rRNA 2'-O-methyltransferase fibrillarin OS=Schizosaccharomyces pombe GN=fib1 PE=1 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.704e-73
Identity = 138/202 (68.32%), Postives = 163/202 (80.69%), Query Frame = 2
Query:  236 SKVVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLE-VILLFLSRKLHRFTCSAGAVFQSEVK 838
            +KV++EPHRH GVFIA+GKED LVT+NLV GE+VYNEKRISV + DGTKVEYR+WNPFRSKLAA +LGG+DNI+IKPG RVLYLGAA+GT+VSHV+D+VGP G+VYAVEFSHRSGRD  +MAKKRTNVIPI+ DARH   YRMLVGMVD +F+DVA PDQARI+ L    F K E  +++ +       T  A  VF  EVK
Sbjct:   71 AKVIIEPHRHAGVFIARGKEDLLVTRNLVPGESVYNEKRISVDSPDGTKVEYRVWNPFRSKLAAGILGGLDNIYIKPGARVLYLGAANGTSVSHVADVVGPEGLVYAVEFSHRSGRDLLNMAKKRTNVIPIVEDARHVQKYRMLVGMVDVVFADVAQPDQARIVALNAAAFLKNEGGVVISVKASCIDSTADAAVVFAREVK 272          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL_RAT (rRNA 2'-O-methyltransferase fibrillarin OS=Rattus norvegicus GN=Fbl PE=1 SV=2)

HSP 1 Score: 265.774 bits (678), Expect = 2.303e-70
Identity = 137/200 (68.50%), Postives = 158/200 (79.00%), Query Frame = 2
Query:  242 VVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKL-EVILLFLSRKLHRFTCSAGAVFQSEVK 838
            V+VEPHRHEGVFI +GKEDALVTKNLV GE+VY EKR+S+   D  K+EYR WNPFRSKLAAA+LGGVD I IKPG +VLYLGAASGTTVSHVSDIVGP+G+VYAVEFSHRSGRD  ++AKKRTN+IP+I DARHP  YRML+ MVD IF+DVA PDQ RI+ L  H F +     ++ +       T SA AVF SEVK
Sbjct:   92 VMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDD-KIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVK 290          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL_MOUSE (rRNA 2'-O-methyltransferase fibrillarin OS=Mus musculus GN=Fbl PE=1 SV=2)

HSP 1 Score: 265.774 bits (678), Expect = 2.303e-70
Identity = 137/200 (68.50%), Postives = 158/200 (79.00%), Query Frame = 2
Query:  242 VVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKL-EVILLFLSRKLHRFTCSAGAVFQSEVK 838
            V+VEPHRHEGVFI +GKEDALVTKNLV GE+VY EKR+S+   D  K+EYR WNPFRSKLAAA+LGGVD I IKPG +VLYLGAASGTTVSHVSDIVGP+G+VYAVEFSHRSGRD  ++AKKRTN+IP+I DARHP  YRML+ MVD IF+DVA PDQ RI+ L  H F +     ++ +       T SA AVF SEVK
Sbjct:   92 VMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDD-KIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVK 290          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL_HUMAN (rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens GN=FBL PE=1 SV=2)

HSP 1 Score: 265.774 bits (678), Expect = 2.303e-70
Identity = 137/200 (68.50%), Postives = 158/200 (79.00%), Query Frame = 2
Query:  242 VVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKL-EVILLFLSRKLHRFTCSAGAVFQSEVK 838
            V+VEPHRHEGVFI +GKEDALVTKNLV GE+VY EKR+S+   D  K+EYR WNPFRSKLAAA+LGGVD I IKPG +VLYLGAASGTTVSHVSDIVGP+G+VYAVEFSHRSGRD  ++AKKRTN+IP+I DARHP  YRML+ MVD IF+DVA PDQ RI+ L  H F +     ++ +       T SA AVF SEVK
Sbjct:   86 VMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDD-KIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVK 284          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL_XENLA (rRNA 2'-O-methyltransferase fibrillarin OS=Xenopus laevis GN=fbl PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 5.132e-70
Identity = 138/202 (68.32%), Postives = 160/202 (79.21%), Query Frame = 2
Query:  239 KVVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDG-TKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKL-EVILLFLSRKLHRFTCSAGAVFQSEVK 838
            KV+VEPHRHEG+FI +GKEDALVTKNLV GE+VY EKRISV  EDG  K EYR WNPFRSK+AAA+LGGVD I IKPGV+VLYLGAASGTTVSHVSD+VGP G+VYAVEFSHRSGRD  ++AKKRTN+IP+I DARHP  YR+LVGMVD +F+DVA PDQ RI+ L  H F K     ++ +       T +  AVF +EVK
Sbjct:   87 KVIVEPHRHEGIFICRGKEDALVTKNLVPGESVYGEKRISV--EDGEVKTEYRAWNPFRSKIAAAILGGVDQIHIKPGVKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPVIEDARHPHKYRILVGMVDVVFADVAQPDQTRIVALNAHNFLKNGGHFVISIKANCIDSTAAPEAVFAAEVK 286          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL_YEAST (rRNA 2'-O-methyltransferase fibrillarin OS=Saccharomyces cerevisiae GN=NOP1 PE=1 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 7.410e-69
Identity = 132/208 (63.46%), Postives = 161/208 (77.40%), Query Frame = 2
Query:  236 SKVVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQN---EDG---TKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLE-VILLFLSRKLHRFTCSAGAVFQSEVK 838
            +KVV+EPHRH GV+IA+GKED LVTKN+  GE+VY EKRISV+    EDG   TKVEYR+WNPFRSKLAA ++GG+D ++I PG +VLYLGAASGT+VSHVSD+VGP GVVYAVEFSHR GR+   MAKKR N+IPII DARHP  YRML+GMVDC+F+DVA PDQARI+ L  H+F K +  +++ +       T  A  VF  EV+
Sbjct:   84 AKVVIEPHRHAGVYIARGKEDLLVTKNMAPGESVYGEKRISVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQ 291          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL_DROER (rRNA 2'-O-methyltransferase fibrillarin OS=Drosophila erecta GN=Fib PE=3 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.651e-68
Identity = 134/200 (67.00%), Postives = 154/200 (77.00%), Query Frame = 2
Query:  242 VVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPL-MHHIFSKLEVILLFLSRKLHRFTCSAGAVFQSEVK 838
            V +EPHRHEGVFIA+GKEDALVT+N V G  VY EKRISV+N +G K+EYR+WNPFRSKLAAAVLGGV+ I + PG +VLYLGAASGTTVSHVSD+VGP G+VYAVEFSHRSGRD  ++AKKRTN+IPII DARHP  YRMLVGMVD IF+DVA PDQ RI+ L   H        ++ +       T    AVF SEVK
Sbjct:  112 VTIEPHRHEGVFIARGKEDALVTRNFVPGSEVYGEKRISVEN-NGEKIEYRVWNPFRSKLAAAVLGGVEQIHMPPGSKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPIIEDARHPHKYRMLVGMVDTIFADVAQPDQGRIVALNAQHFLKNGGHFVISIKASCIDSTAQPEAVFASEVK 310          
BLAST of EY659357 vs. ExPASy Swiss-Prot
Match: FBRL_CANGA (rRNA 2'-O-methyltransferase fibrillarin OS=Candida glabrata GN=NOP1 PE=3 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 6.273e-68
Identity = 131/208 (62.98%), Postives = 161/208 (77.40%), Query Frame = 2
Query:  236 SKVVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQN---EDG---TKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGVRVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDFGHMAKKRTNVIPIIXDARHPAXYRMLVGMVDCIFSDVAPPDQARILPLMHHIFSKLE-VILLFLSRKLHRFTCSAGAVFQSEVK 838
            +KVV+EPH+H+GV+IA+GKED LVTKN+  GE+VY EKR+SV+    EDG   TKVEYR+WNPFRSKLAA ++GG+D ++I PG +VLYLGAASGT+VSHVSD+VGP GVVYAVEFSHR GR+   MAKKR NVIPII DARHP  YRMLVGMVD +F+DVA PDQARI+ L  H+F K +  +++ +       T  A  VF  EV+
Sbjct:   80 AKVVIEPHKHDGVYIARGKEDLLVTKNMAPGESVYGEKRVSVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNVIPIIEDARHPQKYRMLVGMVDAVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQ 287          
The following BLAST results are available for this feature:
BLAST of EY659357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
FBRL1_ARATH1.817e-8376.78rRNA 2'-O-methyltransferase fibrillarin 1 OS=Arabi... [more]
FBRL2_ARATH3.426e-8275.83rRNA 2'-O-methyltransferase fibrillarin 2 OS=Arabi... [more]
FBRL_SCHPO1.704e-7368.32rRNA 2'-O-methyltransferase fibrillarin OS=Schizos... [more]
FBRL_RAT2.303e-7068.50rRNA 2'-O-methyltransferase fibrillarin OS=Rattus ... [more]
FBRL_MOUSE2.303e-7068.50rRNA 2'-O-methyltransferase fibrillarin OS=Mus mus... [more]
FBRL_HUMAN2.303e-7068.50rRNA 2'-O-methyltransferase fibrillarin OS=Homo sa... [more]
FBRL_XENLA5.132e-7068.32rRNA 2'-O-methyltransferase fibrillarin OS=Xenopus... [more]
FBRL_YEAST7.410e-6963.46rRNA 2'-O-methyltransferase fibrillarin OS=Sacchar... [more]
FBRL_DROER1.651e-6867.00rRNA 2'-O-methyltransferase fibrillarin OS=Drosoph... [more]
FBRL_CANGA6.273e-6862.98rRNA 2'-O-methyltransferase fibrillarin OS=Candida... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-C06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659357 ID=EY659357|Name=EY659357|organism=Citrus sinensis|type=EST|length=869bp
CCACGCGTCCGCTTTGTAGCCGGACAGAGCATCAAACATGAGACCTCCAA
GAGGACGCGGTGGTGGCGGTGGGTTCAGGGGAGGCAGAGGTGATGGAGGA
GGAAGAGGAAGAGGTGGCGGCCGAGGTGGTGGAGGTGGAAGAGGTGGTGG
TAGCGCTATGAGAGGCCGAGGTGGCGGTCGTGGCGGTGGCCGAGGTGGAG
GAAGAGGACGCGGTGGTGGAGGAATGAAGGGTGGAAGCAAGGTTGTAGTT
GAGCCTCATAGACACGAAGGAGTGTTCATTGCCAAGGGCAAAGAAGACGC
CCTTGTCACTAAGAATCTCGTCGCCGGTGAGGCTGTCTACAATGAGAAGA
GGATCTCCGTCCAGAATGAAGATGGAACCAAAGTTGAGTATAGAATTTGG
AATCCCTTCCGTTCCAAATTAGCTGCAGCTGTTCTTGGTGGTGTTGATAA
TATTTGGATTAAACCTGGTGTTAGGGTTCTATACCTTGGTGCTGCTTCCG
GCACAACTGTCTCACATGTTTCGGACATTGTTGGCCCTAATGGAGTAGTT
TATGCAGTGGAATTTTCTCATAGAAGTGGTAGAGACTTTGGTCATATGGC
AAAGAAGAGAACCAATGTTATACCCATAATTNGAGATGCTAGACATCCTG
CCNAGTACCGTATGTTGGTCGGTATGGTAGATTGTATATTTTCTGACGTT
GCCCCACCGGATCAGGCGAGGATTTTACCCCTGATGCATCATATTTTCTC
AAAGCTGGAGGTCATTTTGTTATTTCTATCAAGGAAACTGCATAGATTCA
CCTGTTCTGCTGGAGCAGTGTTCCAGAGTGAAGTTAAGACCTGCAACAGG
TCATTCCAACCCTTGAGCA
back to top